DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10000 and Pgant7

DIOPT Version :9

Sequence 1:NP_651630.3 Gene:CG10000 / 43394 FlyBaseID:FBgn0039596 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_001285406.1 Gene:Pgant7 / 32836 FlyBaseID:FBgn0030930 Length:591 Species:Drosophila melanogaster


Alignment Length:517 Identity:167/517 - (32%)
Similarity:262/517 - (50%) Gaps:66/517 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 HTPETSEDFYQYNIHLSNALGLIRKLPVTRHHSCTTRNSILPAPLEANVSVVISFHNEARSMLLR 128
            |..:.||..|..||..|:.:.:.|.:..||...|  |:...|..| ...||:|.||||..|:|:|
  Fly    99 HMSDASEMEYGMNIACSDEISMHRSVRDTRLEEC--RHWDYPFDL-PRTSVIIVFHNEGFSVLMR 160

  Fly   129 TIVSLLSRSPEDYLHELILVDDGSQRDVTLLDDLKRWMGGVFGSRYRLGLTFLRNQERMGLIWSR 193
            |:.|::.|||...|||:|||||.|.:: .|...|..::     .:::..:..:||:||.|||.:|
  Fly   161 TVHSVIDRSPTHMLHEIILVDDFSDKE-NLRSQLDEYV-----LQFKGLVKVIRNKEREGLIRTR 219

  Fly   194 NRGASLASGRYVLFLDSHCEVNEGWLEPLLERLALNTNLAVSPLLDPIDPTTLSYRK---GNELL 255
            :|||..|:|..::|||:|||||..||.|||..:..:..:...|::|.||.....||.   .:...
  Fly   220 SRGAMEATGEVIVFLDAHCEVNTNWLPPLLAPIYRDRTVMTVPIIDGIDHKNFEYRPVYGTDNHF 284

  Fly   256 KGGFDWSLHF-------HWLKRQLTNQESLEMPYQSPAFAGGVLMMSREWFLKLGSFNPYLKIWG 313
            :|.|:|.:.:       ...:|:..|.|    ||:||..|||:..::||:||:||:::|.|.:||
  Fly   285 RGIFEWGMLYKENEVPRREQRRRAHNSE----PYRSPTHAGGLFAINREYFLELGAYDPGLLVWG 345

  Fly   314 GESIELAIKLWLCGGQIEIVPCSRIGHIFRRRHAFDFPPQSDRQLSPAQETYLHNSKIIAESWLD 378
            ||:.||:.|:|.|||.||.|||||:||::|....::|...:.::..|   ....|.|.:.|:|.|
  Fly   346 GENFELSFKIWQCGGSIEWVPCSRVGHVYRGFMPYNFGKLASKKKGP---LITINYKRVIETWFD 407

  Fly   379 E-YKNMFYALRPAARRIPLDHTYDELQRMRKERRCHPFEWYLRHVSPELRMHFDELSAT---GTL 439
            : :|..||...|.||.:.:....::| .::|...|..|:|::.|::.::...|..|.|.   |.|
  Fly   408 DTHKEYFYTREPLARYLDMGDISEQL-ALKKRLNCKSFQWFMDHIAYDVYDKFPGLPANLHWGEL 471

  Fly   440 RN--EDRCVHARQKDSQPI--LASCYLSDITQWSMLRQSGQLSTHRELCLAVGFGMRIALEPCGR 500
            |:  .|.|:.:.......|  |..|:.....|...|..:|||........|...|:::|:  |  
  Fly   472 RSVASDGCLDSMGHQPPAIMGLTYCHGGGNNQLVRLNAAGQLGVGERCVEADRQGIKLAV--C-- 532

  Fly   501 NETVRRSQRWVRLGT------------HLLHAESHLCLD-NPLKDRLEMSTCRSHAVSQSFQ 549
                       ||||            ||:|.....|:. :|...:|.:..|   .|:.|:|
  Fly   533 -----------RLGTVDGPWQYNEHTKHLMHRVHKKCMALHPATQQLSLGHC---DVNDSYQ 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10000NP_651630.3 pp-GalNAc-T 113..422 CDD:133004 118/319 (37%)
Ricin_B_lectin 435..548 CDD:279046 30/132 (23%)
Pgant7NP_001285406.1 Glyco_tranf_2_3 142..373 CDD:290369 98/240 (41%)
pp-GalNAc-T 145..452 CDD:133004 119/320 (37%)
Ricin_B_lectin 468..582 CDD:279046 31/131 (24%)
RICIN 469..584 CDD:238092 31/130 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11675
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.