DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10000 and Pgant5

DIOPT Version :9

Sequence 1:NP_651630.3 Gene:CG10000 / 43394 FlyBaseID:FBgn0039596 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_001036338.1 Gene:Pgant5 / 326151 FlyBaseID:FBgn0031681 Length:630 Species:Drosophila melanogaster


Alignment Length:496 Identity:160/496 - (32%)
Similarity:256/496 - (51%) Gaps:43/496 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 QYNIHLSNALGLIRKLPVTRHHSCTTRN--SILPAPLEANVSVVISFHNEARSMLLRTIVSLLSR 136
            |:|:..|:.:.|.|.|...||..|..::  |.||     ..|:||.|||||.:.||||:.|:::|
  Fly   154 QFNLLASDMISLNRSLTDVRHEGCRRKHYASKLP-----TTSIVIVFHNEAWTTLLRTVWSVINR 213

  Fly   137 SPEDYLHELILVDDGSQRDVTLLDDLKRWMGGVFGSRYRLGLTFLRNQERMGLIWSRNRGASLAS 201
            ||...|.|:|||||.|:||. |...|:.::     ::..:....||.::|.|||.:|..||...|
  Fly   214 SPRALLKEIILVDDASERDF-LGKQLEEYV-----AKLPVKTFVLRTEKRSGLIRARLLGAEHVS 272

  Fly   202 GRYVLFLDSHCEVNEGWLEPLLERLALNTNLAVSPLLDPIDPTTLSYRKGNELLKGGFDWSLHFH 266
            |..:.|||:|||..||||||||.|:..|....|.|::|.|...|..|...::...|||:|.|:|.
  Fly   273 GEVITFLDAHCECTEGWLEPLLARIVQNRRTVVCPIIDVISDETFEYITASDSTWGGFNWKLNFR 337

  Fly   267 WLK---RQLTNQES-LEMPYQSPAFAGGVLMMSREWFLKLGSFNPYLKIWGGESIELAIKLWLCG 327
            |.:   |::..:.: ...|.::|..|||:..:.:::|.::||::..:.|||||::|::.::|:||
  Fly   338 WYRVPSREMARRNNDRTAPLRTPTMAGGLFSIDKDYFYEIGSYDEGMDIWGGENLEMSFRVWMCG 402

  Fly   328 GQIEIVPCSRIGHIFRRRHAFDFPPQSDRQLSPAQETYLHNSKIIAESWLDEYKNMFYALRPAAR 392
            |.:||.||||:||:||:...:.||       ....|...||:..:.|.|||::|..:|:..|.||
  Fly   403 GVLEIAPCSRVGHVFRKSTPYTFP-------GGTTEIVNHNNARLVEVWLDDWKEFYYSFYPGAR 460

  Fly   393 RIPLDHTYDELQRMRKERRCHPFEWYLRHVSPELRMHFDELSATGTLRN--EDRCVH--ARQKDS 453
            :.......|. :.:|...:|..|.|||.:|.||..|..| ....|.:||  .:.|:.  .|:.:.
  Fly   461 KASAGDVSDR-KALRDRLKCKSFRWYLENVYPESLMPLD-YYYLGEIRNAETETCLDTMGRKYNE 523

  Fly   454 QPILASCYLSDITQWSMLRQSGQLSTHRELCL-AVGFGMRIALEPC----GRNETV-RRSQRWVR 512
            :..::.|:.....|.....:..|:.:. :||| |......:.:..|    |..|.| ...::|:|
  Fly   524 KVGISYCHGLGGNQVFAYTKRQQIMSD-DLCLDASSSNGPVNMVRCHNMGGNQEWVYDAEEKWIR 587

  Fly   513 LGTHLLHAESHLCLDNPLKDRLEMSTCRSHAVSQSFQFALE 553
                  |..:..||....:|.......|..:..:..|:.:|
  Fly   588 ------HTNTGQCLQRATRDDANTPLLRPCSYGKGQQWLME 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10000NP_651630.3 pp-GalNAc-T 113..422 CDD:133004 118/312 (38%)
Ricin_B_lectin 435..548 CDD:279046 23/122 (19%)
Pgant5NP_001036338.1 pp-GalNAc-T 190..490 CDD:133004 118/313 (38%)
Ricin_B_lectin 503..619 CDD:395527 23/122 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11675
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.