DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10000 and GALNT8

DIOPT Version :9

Sequence 1:NP_651630.3 Gene:CG10000 / 43394 FlyBaseID:FBgn0039596 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_059113.1 Gene:GALNT8 / 26290 HGNCID:4130 Length:637 Species:Homo sapiens


Alignment Length:532 Identity:167/532 - (31%)
Similarity:270/532 - (50%) Gaps:75/532 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ETSEDFYQ---YNIHLSNALGLIRKLPVTRHHSC--TTRNSILPAPLEANVSVVISFHNEARSML 126
            :.::|.::   ||.:|||.|.|.|.:|.||.:.|  .|..|.||     ::||::.|.|||.|::
Human   138 KAAQDLFRKFGYNAYLSNQLPLNRTIPDTRDYRCLRKTYPSQLP-----SLSVILIFVNEALSII 197

  Fly   127 LRTIVSLLSRSPEDYLHELILVDDGS---QRDVTLLDDLKRWMGGVFGSRYRLGLTFLRNQERMG 188
            .|.|.|:::|:|...|.|:|||||.|   :..|.|.:.:|     ::..:|...|..:|:.||.|
Human   198 QRAITSIINRTPSRLLKEIILVDDFSSNGELKVHLDEKIK-----LYNQKYPGLLKIIRHPERKG 257

  Fly   189 LIWSRNRGASLASGRYVLFLDSHCEVNEGWLEPLLERLALNTNLAVSPLLDPIDPTTLSYRKGNE 253
            |..:||.|...|:...|..||:|.|||.||.||:|.|:..:..:.|||:.|.|...|....| .|
Human   258 LAQARNTGWEAATADVVAILDAHIEVNVGWAEPILARIQEDRTVIVSPVFDNIRFDTFKLDK-YE 321

  Fly   254 LLKGGFDWSLHFHWLKRQLTNQESLEM-----PYQSPAFAGGVLMMSREWFLKLGSFNPYLKIWG 313
            |...||:|.|   |.:.....|..:::     |.:||:.. |:|..:|.:..::||.:..:.|:|
Human   322 LAVDGFNWEL---WCRYDALPQAWIDLHDVTAPVKSPSIM-GILAANRHFLGEIGSLDGGMLIYG 382

  Fly   314 GESIELAIKLWLCGGQIEIVPCSRIGHIFR--RRHAFDFPPQSDRQLSPAQETYLHNSKIIAESW 376
            ||::||::::|.|||::||:|||||.|:.|  :.:|.|......|           |:..:||.|
Human   383 GENVELSLRVWQCGGKVEILPCSRIAHLERHHKPYALDLTAALKR-----------NALRVAEIW 436

  Fly   377 LDEYKNMFYALRPAARRIPLDHT----YDELQRM--RKERRCHPFEWYLRHVSPELR-MHFDELS 434
            :||:|:|.|    .|..|||.::    .|...||  |::.:|..|:|||::|.|.|: :|  .:.
Human   437 MDEHKHMVY----LAWNIPLQNSGIDFGDVSSRMALREKLKCKTFDWYLKNVYPLLKPLH--TIV 495

  Fly   435 ATGTLRN---EDRCV-HARQKDSQPILASC--YLSDITQWSMLRQ--SGQL---STHRELCLA-V 487
            ..|.::|   |:.|: ......:.||:..|  :.|....:.:..:  .|||   ::..:.||. .
Human   496 GYGRMKNLLDENVCLDQGPVPGNTPIMYYCHEFSSQNVYYHLTGELYVGQLIAEASASDRCLTDP 560

  Fly   488 GFGMRIALEPCGRNETVRRSQRW-VRLGTHLLHAESHLCLDNPLKDR-----LEMSTCRSHAVSQ 546
            |...:..||||.:....|....| .:.|..:::.::..||:.. ||.     |.:.||.:..  .
Human   561 GKAEKPTLEPCSKAAKNRLHIYWDFKPGGAVINRDTKRCLEMK-KDLLGSHVLVLQTCSTQV--W 622

  Fly   547 SFQFALEMEGQT 558
            ..|..:...|||
Human   623 EIQHTVRDWGQT 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10000NP_651630.3 pp-GalNAc-T 113..422 CDD:133004 114/324 (35%)
Ricin_B_lectin 435..548 CDD:279046 28/130 (22%)
GALNT8NP_059113.1 transmembrane domain 7..29
stem region 30..148 1/9 (11%)
SMC_N <48..>161 CDD:330553 8/22 (36%)
GT1 motif 182..298 47/120 (39%)
pp-GalNAc-T 184..485 CDD:133004 114/325 (35%)
Gal/GalNAc transferase motif 358..397 13/39 (33%)
RICIN 498..624 CDD:238092 28/128 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.