DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10000 and GALNT1

DIOPT Version :9

Sequence 1:NP_651630.3 Gene:CG10000 / 43394 FlyBaseID:FBgn0039596 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_001371367.1 Gene:GALNT1 / 2589 HGNCID:4123 Length:559 Species:Homo sapiens


Alignment Length:497 Identity:159/497 - (31%)
Similarity:279/497 - (56%) Gaps:47/497 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 QYNIHLSNALGLIRKLPVTRHHSCTTRNSILPAPLEANVSVVISFHNEARSMLLRTIVSLLSRSP 138
            |:|:..|..:.|.|.||..|...|.|:  :.|..| ...||||.|||||.|.||||:.|:::|||
Human    83 QFNLMASEMIALNRSLPDVRLEGCKTK--VYPDNL-PTTSVVIVFHNEAWSTLLRTVHSVINRSP 144

  Fly   139 EDYLHELILVDDGSQRDVTLLDDLKRWMGGVFGSRYRLGLTFLRNQERMGLIWSRNRGASLASGR 203
            ...:.|::||||.|:||.     |||.:.. :..:.::.:..:|.::|.|||.:|.:||:::.|:
Human   145 RHMIEEIVLVDDASERDF-----LKRPLES-YVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQ 203

  Fly   204 YVLFLDSHCEVNEGWLEPLLERLALNTNLAVSPLLDPIDPTTLSYRKGNELLKGGFDWSLHFHWL 268
            .:.|||:|||...|||||||.|:..:....|.|::|.|...|..|..|:::..|||:|.|:|.|.
Human   204 VITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWY 268

  Fly   269 ---KRQLTNQE-SLEMPYQSPAFAGGVLMMSREWFLKLGSFNPYLKIWGGESIELAIKLWLCGGQ 329
               :|::..:: ...:|.::|..|||:..:.|::|.::|:::..:.|||||::|::.::|.|||.
Human   269 PVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGT 333

  Fly   330 IEIVPCSRIGHIFRRRHAFDFPPQSDRQLSPAQETYLHNSKIIAESWLDEYKNMFYALRPAARRI 394
            :|||.||.:||:||:...:.||..:.:.::       .|::.:||.|:||:||.||.:.|...::
Human   334 LEIVTCSHVGHVFRKATPYTFPGGTGQIIN-------KNNRRLAEVWMDEFKNFFYIISPGVTKV 391

  Fly   395 PLDHTYDELQR---MRKERRCHPFEWYLRHVSPELRM--HFDELSATGTLRN--EDRCVH--ARQ 450
                .|.::..   :|.:.:|.||.|||.::.|:.::  |:..|   |.:||  .::|:.  ||:
Human   392 ----DYGDISSRVGLRHKLQCKPFSWYLENIYPDSQIPRHYFSL---GEIRNVETNQCLDNMARK 449

  Fly   451 KDSQPILASCYLSDITQWSMLRQSGQLSTHRELCLAVG-FGMRIALEPCGRNETVRRSQRW---- 510
            ::.:..:.:|:.....|......:.::.|. :|||.|. ....:.:..|   ..::.:|.|    
Human   450 ENEKVGIFNCHGMGGNQVFSYTANKEIRTD-DLCLDVSKLNGPVTMLKC---HHLKGNQLWEYDP 510

  Fly   511 VRLGTHLLHAESHLCLDNPLKDRLEMSTCRSHAVSQSFQFAL 552
            |:|  .|.|..|:.|||...::..::.:.|....|:|.|:.|
Human   511 VKL--TLQHVNSNQCLDKATEEDSQVPSIRDCNGSRSQQWLL 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10000NP_651630.3 pp-GalNAc-T 113..422 CDD:133004 115/315 (37%)
Ricin_B_lectin 435..548 CDD:279046 26/121 (21%)
GALNT1NP_001371367.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..65
Catalytic subdomain A 115..225 52/116 (45%)
pp-GalNAc-T 119..419 CDD:133004 115/316 (36%)
Catalytic subdomain B 285..347 25/61 (41%)
Ricin_B_lectin 432..548 CDD:395527 27/121 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.