DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10000 and gly-4

DIOPT Version :9

Sequence 1:NP_651630.3 Gene:CG10000 / 43394 FlyBaseID:FBgn0039596 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_001024216.1 Gene:gly-4 / 180302 WormBaseID:WBGene00001629 Length:589 Species:Caenorhabditis elegans


Alignment Length:522 Identity:168/522 - (32%)
Similarity:261/522 - (50%) Gaps:97/522 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MNESEESDHLDWRVFIS---------HTPETSEDFYQYNIHLSNALGLIRKLPVTRHHSCT---- 98
            ::|..|.| :.|:.|..         |..|.......:|...|:||...||:|.:|...|.    
 Worm    82 IHERTEKD-VTWKTFDVEKFLNKGKWHQGEDKYKANSFNQEASDALNPTRKIPDSREPQCRDVDY 145

  Fly    99 TRNSILPAPLEANVSVVISFHNEARSMLLRTIVSLLSRSPEDYLHELILVDDGSQRDVTL---LD 160
            ::..:.|      .:|:|::||||||.||||:.|:.::|||:.|.|::||||.|| ||.:   |.
 Worm   146 SKVGMQP------TTVIITYHNEARSSLLRTVFSVFNQSPEELLLEIVLVDDNSQ-DVEIGKELA 203

  Fly   161 DLKRWMGGVFGSRYRLGLTFLRNQERMGLIWSRNRGASLASGRYVLFLDSHCEVNEGWLEPLLER 225
            .::|             :|.|||.:|.|||.||.:||.:|....:.|||||.|.|:.||||||.|
 Worm   204 QIQR-------------ITVLRNNQREGLIRSRVKGAQVARAPVLTFLDSHIECNQKWLEPLLAR 255

  Fly   226 LALNTNLAVSPLLDPIDPTTLSYRKGNELLKGGFDWSLHFHW--LKRQLTNQESLE--MPYQSPA 286
            :|.|....|:|::|.|:....:|...:..|:|||||:|.|.|  :..||..:....  .|.:||.
 Worm   256 IAENPKAVVAPIIDVINVDNFNYVGASADLRGGFDWTLVFRWEFMNEQLRKERHAHPTAPIRSPT 320

  Fly   287 FAGGVLMMSREWFLKLGSFNPYLKIWGGESIELAIKLWLCGGQIEIVPCSRIGHIFRRRHAFDFP 351
            .|||:..:|:|||.:||:::..:::||||::|::.::|.|||.:||:||||:||:||::|.:.||
 Worm   321 MAGGLFAISKEWFNELGTYDLDMEVWGGENLEMSFRVWQCGGSLEIMPCSRVGHVFRKKHPYTFP 385

  Fly   352 PQSDRQLSPAQETYLHNSKIIAESWLDEYKNMFYALRPAARRIPLDHTYDELQRMRKERRCHPFE 416
            ..|.       ..:..|::..||.|:||||.::....|:||.:......|.| .:|...:|..|:
 Worm   386 GGSG-------NVFQKNTRRAAEVWMDEYKAIYLKNVPSARFVNFGDITDRL-AIRDRLQCKSFK 442

  Fly   417 WYLRHVSPELRMHFDELSATGTLRNEDRCVH--ARQKDSQPILASCYLSDITQWSMLRQSGQLST 479
            |||.:|.|:|.:.......:..::..:.|:.  ||::...|.|..|:                  
 Worm   443 WYLENVYPQLEIPRKTPGKSFQMKIGNLCLDSMARKESEAPGLFGCH------------------ 489

  Fly   480 HRELCLAVGFGMRIALEPCGRNETVRRSQRWV--RLGTHLLHAESHLCLD---NPLKDRLEMSTC 539
                    |.|               .:|.||  :|.....:|.|.||||   |.....:.|..|
 Worm   490 --------GTG---------------GNQEWVFDQLTKTFKNAISQLCLDFSSNTENKTVTMVKC 531

  Fly   540 RS 541
            .:
 Worm   532 EN 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10000NP_651630.3 pp-GalNAc-T 113..422 CDD:133004 127/315 (40%)
Ricin_B_lectin 435..548 CDD:279046 21/114 (18%)
gly-4NP_001024216.1 pp-GalNAc-T 154..449 CDD:133004 127/316 (40%)
RICIN 469..582 CDD:238092 21/106 (20%)
Ricin_B_lectin 469..580 CDD:279046 21/106 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 1 1.000 - - FOG0001204
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.