DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10000 and gly-7

DIOPT Version :9

Sequence 1:NP_651630.3 Gene:CG10000 / 43394 FlyBaseID:FBgn0039596 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_503512.1 Gene:gly-7 / 178661 WormBaseID:WBGene00001632 Length:601 Species:Caenorhabditis elegans


Alignment Length:496 Identity:147/496 - (29%)
Similarity:248/496 - (50%) Gaps:37/496 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SEDFYQYNIHLSNALGLIRKLPVTRHHSCTTRNSILPAPLEANVSVVISFHNEARSMLLRTIVSL 133
            :|..:.:|.::|:.:.:.|.:|..|...|  ::...|..| ..||||:.||||..:.||||:.|:
 Worm   118 AEKEFGFNTYVSDMISMNRTIPDIRPEEC--KHWDYPEKL-PTVSVVVVFHNEGWTPLLRTVHSV 179

  Fly   134 LSRSPEDYLHELILVDDGSQRDVTLLDDLKRWMGGVFGSRYRLGLTFLRNQERMGLIWSRNRGAS 198
            |.|||.:.:.::::|||.|.:. .|.:.|.:::     :|:...:..:|.::|.|||.:|:.||.
 Worm   180 LLRSPPELIEQVVMVDDDSDKP-HLKEKLDKYV-----TRFNGKVIVVRTEQREGLINARSIGAK 238

  Fly   199 LASGRYVLFLDSHCEVNEGWLEPLLERLALNTNLAVSPLLDPIDPTTLSYR----KGNELLKGGF 259
            .::|..|||||:|||||..||.|||..:..|..:...|::|.||..:..||    ..|....|.|
 Worm   239 HSTGEVVLFLDAHCEVNTNWLPPLLAPIKRNRKVMTVPVIDGIDSNSWEYRSVYGSPNAHHSGIF 303

  Fly   260 DWSLHFHWLKRQLTNQESL-----EMPYQSPAFAGGVLMMSREWFLKLGSFNPYLKIWGGESIEL 319
            :|.|.:.  :.|:|.:|:.     ..|::||..|||:..::|.||.:||.::..|:|||||..||
 Worm   304 EWGLLYK--ETQITERETAHRKHNSQPFRSPTHAGGLFAINRLWFKELGYYDEGLQIWGGEQYEL 366

  Fly   320 AIKLWLCGGQIEIVPCSRIGHIFRRRHAFDFPPQSDRQLSPAQETYLHNSKIIAESWLDEYKNMF 384
            :.|:|.|||.|..||||.:||::|....:.|...|.:.:...      |...:.::|:|:|...:
 Worm   367 SFKIWQCGGGIVFVPCSHVGHVYRSHMPYSFGKFSGKPVISI------NMMRVVKTWMDDYSKYY 425

  Fly   385 YALRPAARRIPLDHTYDELQRMRKERRCHPFEWYLRHVSPELRMHFDEL---SATGTLRN--EDR 444
            ....|.|..:.......:| .:|.:.:|..|:||:.:|:.::...:..|   ...|..||  ..:
 Worm   426 LTREPQATNVNPGDISAQL-ALRDKLQCKSFKWYMENVAYDVLKSYPMLPPNDVWGEARNPATGK 489

  Fly   445 CVHARQKDSQPILAS-CYLSDITQWSMLRQSGQLSTHRELCLAVGFGMRIALEPCGRNETVRRSQ 508
            |:........|:.|: |:.....|...|...||:: ..|.||... |:||....|.:. ||....
 Worm   490 CLDRMGGIPGPMGATGCHGYGGNQLIRLNVQGQMA-QGEWCLTAN-GIRIQANHCVKG-TVNGFW 551

  Fly   509 RWVRLGTHLLHAESHLCLD-NPLKDRLEMSTCRSHAVSQSF 548
            .:.|....::|::...|:. :.....:.:.||......|.|
 Worm   552 SYDRKTKQIIHSQKRQCITVSESGSEVTLQTCTEDNERQKF 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10000NP_651630.3 pp-GalNAc-T 113..422 CDD:133004 108/317 (34%)
Ricin_B_lectin 435..548 CDD:279046 26/116 (22%)
gly-7NP_503512.1 pp-GalNAc-T 159..463 CDD:133004 108/318 (34%)
Ricin_B_lectin 479..592 CDD:279046 26/115 (23%)
RICIN 486..592 CDD:238092 23/108 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.