DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10000 and Galnt3

DIOPT Version :9

Sequence 1:NP_651630.3 Gene:CG10000 / 43394 FlyBaseID:FBgn0039596 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_056551.2 Gene:Galnt3 / 14425 MGIID:894695 Length:633 Species:Mus musculus


Alignment Length:616 Identity:186/616 - (30%)
Similarity:292/616 - (47%) Gaps:128/616 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HCSFYIIAFLICQLFFLVIFI------------------RNDDASSANELLSFMNESEES----- 53
            |..|:.:..:|  .||||:.|                  ||  ..:.|::|.||.|:..:     
Mouse    17 HRKFWKLGAVI--FFFLVVLILMQREVSVQYSKEESKMERN--LKNKNKMLDFMLEAVNNIKDAM 77

  Fly    54 ----------DHLDWR----------------VF------------------ISH-TP------E 67
                      :::|.|                ||                  |:| :|      |
Mouse    78 PKMQIGAPIKENIDVRERPCLQGYYTAAELKPVFDRPPQDSNAPGASGKPFKITHLSPEEQKEKE 142

  Fly    68 TSEDFYQYNIHLSNALGLIRKL-PVTRHHSCTTRNSILPAPLEANVSVVISFHNEARSMLLRTIV 131
            ..|..:.:|...|:.:.|.|.| |.||...|..:......|| ...||:|.|||||.|.||||:.
Mouse   143 RGETKHCFNAFASDRISLHRDLGPDTRPPECIEQKFKRCPPL-PTTSVIIVFHNEAWSTLLRTVH 206

  Fly   132 SLLSRSPEDYLHELILVDDGSQRDVTLLDDLKRWMGGVFGSRYRLGLTFLRNQERMGLIWSRNRG 196
            |:|..||...|.|:|||||.|..|. |.:.|:.::     .::.: :..:|.|||.|||.:|..|
Mouse   207 SVLYSSPAILLKEIILVDDASVDDY-LHEKLEEYI-----KQFSI-VKIVRQQERKGLITARLLG 264

  Fly   197 ASLASGRYVLFLDSHCEVNEGWLEPLLERLALNTNLAVSPLLDPIDPTTLSYRK----GNELLKG 257
            |::|:...:.|||:|||...|||||||.|:|.|....|||.:..||..|..:.|    |:...:|
Mouse   265 AAVATAETLTFLDAHCECFYGWLEPLLARIAENYTAVVSPDIASIDLNTFEFNKPSPYGSNHNRG 329

  Fly   258 GFDWSLHFHW-----LKRQLTNQESLEMPYQSPAFAGGVLMMSREWFLKLGSFNPYLKIWGGESI 317
            .|||||.|.|     .::|....|:  .|.::|.||||:..:|:::|..:||::..::|||||:|
Mouse   330 NFDWSLSFGWESLPDHEKQRRKDET--YPIKTPTFAGGLFSISKKYFEHIGSYDEEMEIWGGENI 392

  Fly   318 ELAIKLWLCGGQIEIVPCSRIGHIFRRRHAFDFPPQSDRQLSPAQETYLHNSKIIAESWLDEYKN 382
            |::.::|.||||:||:|||.:||:||.:....||        ...:....|...:||.|:||||.
Mouse   393 EMSFRVWQCGGQLEIMPCSVVGHVFRSKSPHTFP--------KGTQVIARNQVRLAEVWMDEYKE 449

  Fly   383 MFYALRPAARRIPLDHTYDELQR---MRKERRCHPFEWYLRHVSPELRMHFDELS--ATGTLRN- 441
            :||.....|.:|....::.:|.:   ::|..:|..|.|||..:.||  .:..:|:  .:|.::: 
Mouse   450 IFYRRNTDAAKIVKQKSFGDLSKRFEIKKRLQCKNFTWYLNTIYPE--AYVPDLNPVISGYIKSV 512

  Fly   442 -EDRC--VHARQKDSQP-ILASCY---LSDITQWSMLRQSGQLSTHRELCLAVGFGMRIALEPCG 499
             :..|  |....:..:| ||.:|:   .:...::|..|:. :.:..:||||....|: :.|:.| 
Mouse   513 GQPLCLDVGENNQGGKPLILYTCHGLGGNQYFEYSAQREI-RHNIQKELCLHATQGV-VQLKAC- 574

  Fly   500 RNETVRRSQRWVRLGTHLLHAESHLCLDNPL 530
                |.:..|.:..|..:........|.|||
Mouse   575 ----VYKGHRTIAPGEQIWEIRKDQLLYNPL 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10000NP_651630.3 pp-GalNAc-T 113..422 CDD:133004 125/320 (39%)
Ricin_B_lectin 435..548 CDD:279046 23/104 (22%)
Galnt3NP_056551.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..145 4/32 (13%)
WcaA 184..>302 CDD:223539 56/125 (45%)
Catalytic subdomain A 184..293 53/116 (46%)
pp-GalNAc-T 188..493 CDD:133004 125/321 (39%)
Catalytic subdomain B 356..418 29/61 (48%)
Ricin_B_lectin 506..627 CDD:279046 23/103 (22%)
RICIN 507..629 CDD:238092 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.