DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10000 and GALNT5

DIOPT Version :9

Sequence 1:NP_651630.3 Gene:CG10000 / 43394 FlyBaseID:FBgn0039596 Length:558 Species:Drosophila melanogaster
Sequence 2:XP_016858726.1 Gene:GALNT5 / 11227 HGNCID:4127 Length:956 Species:Homo sapiens


Alignment Length:513 Identity:168/513 - (32%)
Similarity:269/513 - (52%) Gaps:80/513 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YNIHLSNALGLIRKLPVTRHHSCTTR--NSILPAPLEANVSVVISFHNEARSMLLRTIVSLLSRS 137
            :|::||:.:.:.|.:..||...|..:  ::.||     ..||::.|.:|..|.|||::.|:::||
Human   464 FNVYLSDLIPVDRAIEDTRPAGCAEQLVHNNLP-----TTSVIMCFVDEVWSTLLRSVHSVINRS 523

  Fly   138 PEDYLHELILVDDGSQRDVTLLDDLKRWMGGVFGSRYRLGLTFLRNQERMGLIWSRNRGASLASG 202
            |...:.|::||||.|.:|. |.|:|.::|     |::. .:..||.:||.|||.:|..||..|:|
Human   524 PPHLIKEILLVDDFSTKDY-LKDNLDKYM-----SQFP-KVRILRLKERHGLIRARLAGAQNATG 581

  Fly   203 RYVLFLDSHCEVNEGWLEPLLERLALNTNLAVSPLLDPIDPTTLSYRKGNELLKGGFDWSLHFHW 267
            ..:.|||||.|.|.|||||||||:.|:......|:::.|:...:||...:...:|.|.|.::|.|
Human   582 DVLTFLDSHVECNVGWLEPLLERVYLSRKKVACPVIEVINDKDMSYMTVDNFQRGIFVWPMNFGW 646

  Fly   268 --------LKRQLTNQESLEMPYQSPAFAGGVLMMSREWFLKLGSFNPYLKIWGGESIELAIKLW 324
                    .|.::...:::    :.|..|||:..:.:.:|.:||:::|.|.:||||::||:.|:|
Human   647 RTIPPDVIAKNRIKETDTI----RCPVMAGGLFSIDKSYFFELGTYDPGLDVWGGENMELSFKVW 707

  Fly   325 LCGGQIEIVPCSRIGHIFRRRHAFDFPPQSDRQLSPAQETYLHNSKIIAESWLDEYKNMFYALRP 389
            :|||:|||:||||:|||||..:.:.||  .||     .:|...|...:||.||||||.:||... 
Human   708 MCGGEIEIIPCSRVGHIFRNDNPYSFP--KDR-----MKTVERNLVRVAEVWLDEYKELFYGHG- 764

  Fly   390 AARRIPLDHTYD---------ELQRMRKERRCHPFEWYLRHVSPELRMHFDELSATGTLRNE--D 443
                   ||..|         :.:.:||:.:|..|:|||.:|.|:||...  :.|:|.|.|.  .
Human   765 -------DHLIDQGLDVGNLTQQRELRKKLKCKSFKWYLENVFPDLRAPI--VRASGVLINVALG 820

  Fly   444 RCVHARQKDSQPILASCYLSDITQ-----WSMLRQSGQLSTHRELCLA-VGFGMRIALEPC-GRN 501
            :|:..  :::..||..|..|...|     |..|.:.|      |.|:| :.....:.|.|| .||
Human   821 KCISI--ENTTVILEDCDGSKELQQFNYTWLRLIKCG------EWCIAPIPDKGAVRLHPCDNRN 877

  Fly   502 ETVRRSQRWVRLGTHLLHAE---SHLCLDNPLKDRLEMSTCRSHAVSQSFQFALEMEG 556
                :..:|:...|.:.|.|   :..|...|....|::    :|.|.::.|..|.:||
Human   878 ----KGLKWLHKSTSVFHPELLSNSACGSFPALLSLQV----NHIVFENNQQLLCLEG 927

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10000NP_651630.3 pp-GalNAc-T 113..422 CDD:133004 121/325 (37%)
Ricin_B_lectin 435..548 CDD:279046 30/124 (24%)
GALNT5XP_016858726.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.