DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10000 and GALNT6

DIOPT Version :9

Sequence 1:NP_651630.3 Gene:CG10000 / 43394 FlyBaseID:FBgn0039596 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_009141.2 Gene:GALNT6 / 11226 HGNCID:4128 Length:622 Species:Homo sapiens


Alignment Length:523 Identity:175/523 - (33%)
Similarity:267/523 - (51%) Gaps:64/523 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TP-ETSEDFYQYNIHLSNA-----LGLIRKL-PVTRHHSCTTRNSILPAPLEANVSVVISFHNEA 122
            || ||.|....|..|..||     :.|.|.| |.||...|..:......|| |..||:|.|||||
Human   126 TPLETQEKEEGYKKHCFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPL-ATTSVIIVFHNEA 189

  Fly   123 RSMLLRTIVSLLSRSPEDYLHELILVDDGSQRDVTLLDDLKRWMGGVFGSRYRLGLTFLRNQERM 187
            .|.||||:.|:|..:|...|.|:|||||.|..: .|.:.|::::      :....:..:|.:||.
Human   190 WSTLLRTVYSVLHTTPAILLKEIILVDDASTEE-HLKEKLEQYV------KQLQVVRVVRQEERK 247

  Fly   188 GLIWSRNRGASLASGRYVLFLDSHCEVNEGWLEPLLERLALNTNLAVSPLLDPIDPTTLSYRK-- 250
            |||.:|..|||:|....:.|||:|||...|||||||.|:|.:..:.|||.:..||..|..:.|  
Human   248 GLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTVVVSPDIVTIDLNTFEFAKPV 312

  Fly   251 --GNELLKGGFDWSLHFHW-----LKRQLTNQESLEMPYQSPAFAGGVLMMSREWFLKLGSFNPY 308
              |....:|.|||||.|.|     .::|....|:  .|.:||.||||:..:|:.:|..:|:::..
Human   313 QRGRVHSRGNFDWSLTFGWETLPPHEKQRRKDET--YPIKSPTFAGGLFSISKSYFEHIGTYDNQ 375

  Fly   309 LKIWGGESIELAIKLWLCGGQIEIVPCSRIGHIFRRRHAFDFPPQSDRQLSPAQETYLHNSKIIA 373
            ::|||||::|::.::|.||||:||:|||.:||:||.:....||        ........|...:|
Human   376 MEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFP--------KGTSVIARNQVRLA 432

  Fly   374 ESWLDEYKNMFYALRPAARRIPLDHTYDELQ---RMRKERRCHPFEWYLRHVSPELRMHFDELSA 435
            |.|:|.||.:||.....|.::..:.::.::.   ::|::..||.|.|||.:|.||  |...:|:.
Human   433 EVWMDSYKKIFYRRNLQAAKMAQEKSFGDISERLQLREQLHCHNFSWYLHNVYPE--MFVPDLTP 495

  Fly   436 T--GTLRN--EDRC--VHARQKDSQP-ILASC-------YLSDITQWSMLRQSGQLSTHRELCLA 486
            |  |.::|  .::|  |....:..:| |:.||       |....||..:     :.:..::|||.
Human   496 TFYGAIKNLGTNQCLDVGENNRGGKPLIMYSCHGLGGNQYFEYTTQRDL-----RHNIAKQLCLH 555

  Fly   487 VGFGMRIALEPC---GRNETVRRSQRWVRLGTHLL-HAESHLCLDNPLKDRLEMSTCRSHAVSQS 547
            |..| .:.|..|   |:|..|.:.:.|......|: ::.|..||.:..| :..|:.|......|.
Human   556 VSKG-ALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDK-KPAMAPCNPSDPHQL 618

  Fly   548 FQF 550
            :.|
Human   619 WLF 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10000NP_651630.3 pp-GalNAc-T 113..422 CDD:133004 119/320 (37%)
Ricin_B_lectin 435..548 CDD:279046 31/130 (24%)
GALNT6NP_009141.2 Catalytic subdomain A 176..285 52/116 (45%)
pp-GalNAc-T 180..485 CDD:133004 119/321 (37%)
Catalytic subdomain B 348..410 28/61 (46%)
Ricin_B_lectin 497..619 CDD:306998 30/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.