DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10000 and Galnt6

DIOPT Version :9

Sequence 1:NP_651630.3 Gene:CG10000 / 43394 FlyBaseID:FBgn0039596 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_001165534.1 Gene:Galnt6 / 100361647 RGDID:2319726 Length:622 Species:Rattus norvegicus


Alignment Length:517 Identity:172/517 - (33%)
Similarity:265/517 - (51%) Gaps:64/517 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 DWRVFISHTPETSEDF--YQYNIHLSNALGLIRKL-PVTRHHSCTTRNSILPAPLEANVSVVISF 118
            :|.:.  .|.|..|.:  :.:|...|:.:.|.|.| |.||...|..:......|| ...||||.|
  Rat   124 EWTLL--ETQEKDEGYKKHCFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPL-PTTSVVIVF 185

  Fly   119 HNEARSMLLRTIVSLLSRSPEDYLHELILVDDGSQRDVTLLDDLKRWMGGVFGSRYRLGLTFLRN 183
            ||||.|.||||:.|:|..||...|.|:|||||.| .|..|.:.|:|::     .:.:: :..:|.
  Rat   186 HNEAWSTLLRTVYSVLHTSPAILLKEIILVDDAS-TDEHLKEKLERYV-----QQLQI-VRVVRQ 243

  Fly   184 QERMGLIWSRNRGASLASGRYVLFLDSHCEVNEGWLEPLLERLALNTNLAVSPLLDPIDPTTLSY 248
            |||.|||.:|..|||:|....:.|||:|||...|||||||.|:|.:....|||.:..||..|..:
  Rat   244 QERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTAVVSPDIVTIDLNTFQF 308

  Fly   249 ----RKGNELLKGGFDWSLHFHW-----LKRQLTNQESLEMPYQSPAFAGGVLMMSREWFLKLGS 304
                |:|....:|.|||||.|.|     .::|....|:  .|.:||.||||:..:|:.:|..:|:
  Rat   309 SKPMRRGKAHSRGNFDWSLTFGWEMLPEHEKQRRKDET--YPIKSPTFAGGLFSISKAYFEHIGT 371

  Fly   305 FNPYLKIWGGESIELAIKLWLCGGQIEIVPCSRIGHIFRRRHAFDFPPQSDRQLSPAQETYLHNS 369
            ::..::|||||::|::.::|.||||:||:|||.:||:||.:....||        ........|.
  Rat   372 YDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFP--------KGTSVIARNQ 428

  Fly   370 KIIAESWLDEYKNMFYALRPAARRIPLDHTYDELQ---RMRKERRCHPFEWYLRHVSPELRMHFD 431
            ..:||.|:|:||.:||.....|.::..::.:.::.   |:|::..||.|.|||.:|.||  |...
  Rat   429 VRLAEVWMDDYKKIFYRRNLQAAKMAKENNFGDVSERLRLREQLHCHNFSWYLHNVYPE--MFVP 491

  Fly   432 ELSAT--GTLRN--EDRC--VHARQKDSQPIL--------ASCYLSDITQWSMLRQSGQLSTHRE 482
            :|:.|  |.::|  ..:|  |....:..:|::        .:.|....:|..:....|     ::
  Rat   492 DLNPTFSGAIKNLGTSQCLDVGENNRGGKPLIMYVCHNLGGNQYFEYTSQRDLRHNIG-----KQ 551

  Fly   483 LCLAVGFGMRIALEPC---GRNETVRRSQRWVRLGTHLL-HAESHLCLDNPLKDRL-EMSTC 539
            |||... |..:.|..|   |:|..|.:.:.|......|: :..|..||.:  ||:. .|:.|
  Rat   552 LCLHAS-GSTLGLRNCQFIGKNSEVPKDEEWELTQDQLIRNLGSGTCLTS--KDKKPAMAPC 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10000NP_651630.3 pp-GalNAc-T 113..422 CDD:133004 125/320 (39%)
Ricin_B_lectin 435..548 CDD:279046 27/124 (22%)
Galnt6NP_001165534.1 pp-GalNAc-T 180..485 CDD:133004 125/321 (39%)
Ricin_B_lectin 497..619 CDD:395527 26/122 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.