DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R2 and KISS1R

DIOPT Version :9

Sequence 1:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_115940.2 Gene:KISS1R / 84634 HGNCID:4510 Length:398 Species:Homo sapiens


Alignment Length:325 Identity:104/325 - (32%)
Similarity:163/325 - (50%) Gaps:33/325 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AINGTLP-------WIVGFFFGVIAITGFFGNLLVILVVVFNNNMRSTTNLMIVNLAAADLMFVI 89
            |.:|.:|       |:|..||..:.:.|..||.|||.|:..:..||:.||..|.||||.|:.|::
Human    29 ASDGPVPSPRAVDAWLVPLFFAALMLLGLVGNSLVIYVICRHKPMRTVTNFYIANLAATDVTFLL 93

  Fly    90 LCIPFTATDYMVYYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENI 154
            .|:||||..|.:..|..|.|.|:.|.|:..|:..|:..||..||:||:...|.|:|:...||..:
Human    94 CCVPFTALLYPLPGWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRL 158

  Fly   155 TLIAIVTLWIVVLVVSVPVAFTHDVVVDYDAKKNITYGMCTFTTNDFLG---PRTYQVTFFISSY 216
            .|...:::|:....||.||...|          .::.|...:.:..|..   .|.:.:...::.|
Human   159 ALAVSLSIWVGSAAVSAPVLALH----------RLSPGPRAYCSEAFPSRALERAFALYNLLALY 213

  Fly   217 LLPLMIISGLYMRMIMRLWRQGT----------GVRMSKESQRGRKRVTRLVVVVVIAFASLWLP 271
            ||||:.....|..|:..|.|...          |..:::.:...|.:|:|||..||:.||:.|.|
Human   214 LLPLLATCACYAAMLRHLGRVAVRPAPADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGP 278

  Fly   272 VQLILLLKSLDVI---ETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKAVNCSSR 333
            :||.|:|::|...   ...:.....::..|..::||:|.:||||||||..:||:||.:...|:.|
Human   279 IQLFLVLQALGPAGSWHPRSYAAYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPR 343

  Fly   334  333
            Human   344  343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 44/116 (38%)
7tm_1 55..313 CDD:278431 85/273 (31%)
KISS1RNP_115940.2 7tm_4 53..>157 CDD:304433 43/103 (42%)
7tm_1 59..323 CDD:278431 85/273 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..363 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1294084at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9822
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.