DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R2 and Gpr84

DIOPT Version :9

Sequence 1:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001102979.1 Gene:Gpr84 / 688730 RGDID:1585277 Length:396 Species:Rattus norvegicus


Alignment Length:393 Identity:89/393 - (22%)
Similarity:148/393 - (37%) Gaps:135/393 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IVGF-FFGVI-----AITGFFGNLLVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIPFTATD 98
            ::|: :|.||     |.||..||:|.:|.:.....:|:..||:|.||..|||::..|..||:...
  Rat    16 VLGYRYFAVIWGMVVAATGTVGNVLTLLALAIRPKLRTRFNLLIANLTLADLLYCTLLQPFSVDT 80

  Fly    99 YMVYYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHP-IRSRMMRTENITLIAIVTL 162
            |:..:|..|..:||....|:..:...||.||.|:::.|:|.:.|| :..::...:.|.| |:|..
  Rat    81 YLHLHWRTGAIFCRIFGLLLFTSNSVSILTLCLIALGRYLLIAHPKLFPQVFSAKGIVL-ALVGS 144

  Fly   163 WIVVLV---------VSVPVAFTHDVVVDYDAKKNITYGMCTFTTNDFLGPRTYQVTFFISSYLL 218
            |:|.:.         |.|||..|                 |:|   |.:..|.|........:::
  Rat   145 WVVGVTSFAPLWNVYVLVPVVCT-----------------CSF---DRVRGRPYTTILMGIFFVV 189

  Fly   219 PLMIISGLYM---RMIMRLWR-----------------QGT------------------------ 239
            .|..:...|.   |.:.|..|                 .||                        
  Rat   190 GLSSVGVFYCLIHRQVKRAARALDKYGLQEASMRSHQVSGTHEAVPGHFQELDSGLASRGPSEGI 254

  Fly   240 -----------------------GVRMSKE--SQRG-----RK------------------RVTR 256
                                   |:|.:.:  |:|.     ||                  :|||
  Rat   255 SSEPVSAATTQTLEGDSSEAGDQGMRKAAQQISERSLPEVHRKTGGAAGARRATDAPSEFGKVTR 319

  Fly   257 LVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFR 321
            :...|.:.|...::|..|      |::::.......|:.:.|..|.:.:|||||:|||.::..||
  Rat   320 MCFAVFLCFVLSYIPFLL------LNILDARGRAPRVVHMVAANLTWLNSCINPVLYAAMNRQFR 378

  Fly   322 KAF 324
            :|:
  Rat   379 QAY 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 40/122 (33%)
7tm_1 55..313 CDD:278431 76/359 (21%)
Gpr84NP_001102979.1 7tm_4 29..>171 CDD:304433 47/162 (29%)
7tm_1 37..>210 CDD:278431 51/193 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.