DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R2 and CXCR5

DIOPT Version :10

Sequence 1:NP_524544.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001707.1 Gene:CXCR5 / 643 HGNCID:1060 Length:372 Species:Homo sapiens


Alignment Length:38 Identity:8/38 - (21%)
Similarity:21/38 - (55%) Gaps:1/38 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SPIQEDGNW-LDTYGYSAFEGQFPYHAEVRIKPISLSY 75
            :|.::...| :|||.::|...|..:...::::|..:.:
Human  1441 APWEDPAKWVMDTYPWAASPQQHEWPPLLQLRPEDVGF 1478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_524544.1 7tmA_AstA_R_insect 39..324 CDD:320224 8/38 (21%)
TM helix 1 40..66 CDD:320224 7/26 (27%)
TM helix 2 73..99 CDD:320224 0/3 (0%)
TM helix 3 111..141 CDD:320224
TM helix 4 153..173 CDD:320224
TM helix 5 204..233 CDD:320224
TM helix 6 249..279 CDD:320224
TM helix 7 292..317 CDD:320224
CXCR5NP_001707.1 7tmA_CXCR5 52..333 CDD:341336
TM helix 1 52..79 CDD:341336
TM helix 2 86..111 CDD:341336
TM helix 3 122..152 CDD:341336
TM helix 4 164..186 CDD:341336
TM helix 5 215..244 CDD:341336
TM helix 6 252..282 CDD:341336
TM helix 7 301..326 CDD:341336
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.