DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R2 and CYSLTR2

DIOPT Version :9

Sequence 1:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001295394.1 Gene:CYSLTR2 / 57105 HGNCID:18274 Length:346 Species:Homo sapiens


Alignment Length:369 Identity:97/369 - (26%)
Similarity:167/369 - (45%) Gaps:78/369 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NTTMLANISLNATRNEENI-TSFFTDEEWLAINGTLPWIVGFFFGVIAITGFFGNLLVILVVVFN 66
            |.|...|.|.|.|  .||. ..||          .:.:::.||:||:      ||.|.|.|.:..
Human    20 NGTFSNNNSRNCT--IENFKREFF----------PIVYLIIFFWGVL------GNGLSIYVFLQP 66

  Fly    67 NNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYY-----WPYGRFWCRSVQYLIVVTAFASI 126
            ....::.|:.::|||.:||:| |..:||.|.    ||     |.:|...||.:.|.:.|..::||
Human    67 YKKSTSVNVFMLNLAISDLLF-ISTLPFRAD----YYLRGSNWIFGDLACRIMSYSLYVNMYSSI 126

  Fly   127 YTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVVLVVSVPVAFTHDVVVDYDAKKN--I 189
            |.|.::|:.||||:|||.|...:.:.....|....:||:::..|:       :::|..:::|  :
Human   127 YFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSI-------MLLDSGSEQNGSV 184

  Fly   190 T-------YGMCTFTTNDFLGPRTYQVTFFISSYLLPLMIISGLYM---RMIMRLWRQGTGVRMS 244
            |       |.:....|.:::.        .:...|||...:|..|:   |:::::....:|:|:|
Human   185 TSCLELNLYKIAKLQTMNYIA--------LVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRVS 241

  Fly   245 KESQRGRKRVTRLVVVVVIAFASLWLPVQLI----LLLKSLDVIETNTLTKLVIQVTAQTLAYSS 305
            .     ||.:|.:::.::|.|. .:||...:    |....:.:.:......|||.:   .||.::
Human   242 H-----RKALTTIIITLIIFFL-CFLPYHTLRTVHLTTWKVGLCKDRLHKALVITL---ALAAAN 297

  Fly   306 SCINPLLYAFLSENFRKAFYKAVNCSSRYQNYTSDLPPPRKTSC 349
            :|.|||||.|..|||:.....|:.         ...|...||.|
Human   298 ACFNPLLYYFAGENFKDRLKSALR---------KGHPQKAKTKC 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 39/121 (32%)
7tm_1 55..313 CDD:278431 72/278 (26%)
CYSLTR2NP_001295394.1 7tmA_CysLTR2 39..316 CDD:320285 84/321 (26%)
TM helix 1 41..65 CDD:320285 10/39 (26%)
TM helix 2 74..95 CDD:320285 10/21 (48%)
TM helix 3 112..134 CDD:320285 7/21 (33%)
TM helix 4 157..173 CDD:320285 4/22 (18%)
TM helix 5 199..222 CDD:320285 5/30 (17%)
TM helix 6 246..268 CDD:320285 5/22 (23%)
TM helix 7 284..309 CDD:320285 12/27 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.