DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R2 and ACKR3

DIOPT Version :9

Sequence 1:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_064707.1 Gene:ACKR3 / 57007 HGNCID:23692 Length:362 Species:Homo sapiens


Alignment Length:332 Identity:79/332 - (23%)
Similarity:138/332 - (41%) Gaps:45/332 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FTDEEW-----------------LAINGTLPWIVGFFFGVIAITGFFGNLLVILVVVFNNNMRST 72
            |:|..|                 :.....|.:.:.|.:..|.:.|...|.:|:.|.:........
Human    14 FSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYD 78

  Fly    73 TNLMIVNLAAADLMFVILCIPFTATDYMVY-YWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDR 136
            |:..|:|||.||| :|:|.||......:.: .||.|...|:....:..:..|.||:.|..||:||
Human    79 THCYILNLAIADL-WVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDR 142

  Fly   137 FLAVVHPIRSRMMRTENITLIAIVTLWIVVLVVSVPVAFTHDVVVDYDAKKNITYGMCTFTTND- 200
            :|::.:...:...|.:.:..:..:.:|::...||:|..:....|.  .|..|.||....:..:. 
Human   143 YLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVT--SASNNETYCRSFYPEHSI 205

  Fly   201 ---FLGPRTYQVTFFISSYLLPLMIISGLYMRMIMRLWRQGTGVRMSKESQRGRKRVTRLVVVVV 262
               .:|.....|   :..:.:|..||:..|.     |..:.......:|....||.:...|||.:
Human   206 KEWLIGMELVSV---VLGFAVPFSIIAVFYF-----LLARAISASSDQEKHSSRKIIFSYVVVFL 262

  Fly   263 IAFASLWLPVQLILLLKSLDVIETNTLT-KL------VIQVTAQTLAYSSSCINPLLYAFLSENF 320
            :.    |||..:.:||....::.....| :|      .:.|| |.|:....|:||:||:|::.|:
Human   263 VC----WLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVT-QCLSLVHCCVNPVLYSFINRNY 322

  Fly   321 RKAFYKA 327
            |....||
Human   323 RYELMKA 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 31/117 (26%)
7tm_1 55..313 CDD:278431 65/269 (24%)
ACKR3NP_064707.1 7tm_1 62..315 CDD:278431 65/268 (24%)
C-terminal cytoplasmic tail 324..362 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147277
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.