DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R2 and rgra

DIOPT Version :9

Sequence 1:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001017877.1 Gene:rgra / 550575 ZFINID:ZDB-GENE-040924-6 Length:295 Species:Danio rerio


Alignment Length:284 Identity:67/284 - (23%)
Similarity:125/284 - (44%) Gaps:34/284 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VIAITGFFGNLLVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYYWPYGRFWC 111
            |..:.|||.|.:.::..:....:|:.:|.::.:||.|| |.:.......|....:.|||||...|
Zfish    25 VEGLLGFFLNAVTVIAFLKIRELRTPSNFLVFSLAMAD-MGISTNATVAAFSSFLRYWPYGSDGC 88

  Fly   112 RSVQYLIVVTAFASIYTLVLMSIDRFLAVVHP--IRSRMMRTENITLIAIVTLWIVVLVVSVPVA 174
            ::..:...:||.|||:.:..::.||:    |.  .|:::..:..|||:...  |:.....:....
Zfish    89 QTHGFQGFMTALASIHFIAAIAWDRY----HQYCTRTKLQWSSAITLVLFT--WLFTAFWAAMPL 147

  Fly   175 FTHDVVVDYDAKKNITYGMCTFTTNDF-LGPRTYQVTFFISSYLLPLMIIS-GLYMRMIMRLWRQ 237
            |...   :||.:.     :.|..|.|: .|.|.|      .|||:|:.|.: |:.:.:::..: |
Zfish   148 FGWG---EYDYEP-----LRTCCTLDYSKGDRNY------VSYLIPMSIFNMGIQVFVVLSSY-Q 197

  Fly   238 GTGVRMSKESQRGRKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKLVIQVTAQTLA 302
            ....:..|..|......|.|..::.     .|.|..::....:   :|..||....:::.|..||
Zfish   198 SIDKKFKKTGQAKFNCGTPLKTMLF-----CWGPYGILAFYAA---VENATLVSPKLRMIAPILA 254

  Fly   303 YSSSCINPLLYAFLSENFRKAFYK 326
            .:|...|..:||..:||:|...::
Zfish   255 KTSPTFNVFVYALGNENYRGGIWQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 31/118 (26%)
7tm_1 55..313 CDD:278431 58/261 (22%)
rgraNP_001017877.1 7tm_1 34..265 CDD:278431 58/260 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.