DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R2 and RXFP3

DIOPT Version :9

Sequence 1:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_057652.1 Gene:RXFP3 / 51289 HGNCID:24883 Length:469 Species:Homo sapiens


Alignment Length:326 Identity:90/326 - (27%)
Similarity:148/326 - (45%) Gaps:51/326 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IVGFFFGVIAITGFFGNLLVILVVVFNNNMR-STTNLMIVNLAAADLMFVILCIPFTATDYMV-Y 102
            ::...:.|:...|..|||||:.::......| |:.||.:.|||..|..|| |.:||.|.:..: :
Human    83 LISVVYWVVCALGLAGNLLVLYLMKSMQGWRKSSINLFVTNLALTDFQFV-LTLPFWAVENALDF 146

  Fly   103 YWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTEN-------------- 153
            .||:|:..|:.|..:..:..:||::.|..||:.|:.:|...::|...|...              
Human   147 KWPFGKAMCKIVSMVTSMNMYASVFFLTAMSVTRYHSVASALKSHRTRGHGRGDCCGRSLGDSCC 211

  Fly   154 ITLIAI-VTLWIVVLVVSVPVAFTHDVVVDYDAKKNITYGMCTFTTNDFLGPRTYQVTFFISSY- 216
            .:..|: |.:|.:..:.|:|.|.....|      |.:...:|.....|.|..|..|  |::..| 
Human   212 FSAKALCVWIWALAALASLPSAIFSTTV------KVMGEELCLVRFPDKLLGRDRQ--FWLGLYH 268

  Fly   217 --------LLPLMIISGLYM---RMIMRLWRQGT-------GVRMSKESQRGRKRVTRLVVVVVI 263
                    :|||.||...|:   |.|......||       |.|.:..|.|...:||:.|.:||:
Human   269 SQKVLLGFVLPLGIIILCYLLLVRFIADRRAAGTKGGAAVAGGRPTGASARRLSKVTKSVTIVVL 333

  Fly   264 AFASLWLPVQLI----LLLK--SLDVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRK 322
            :|...|||.|.:    :|:|  ::...:...|.::.....:..||:|:||:||:||..:...|||
Human   334 SFFLCWLPNQALTTWSILIKFNAVPFSQEYFLCQVYAFPVSVCLAHSNSCLNPVLYCLVRREFRK 398

  Fly   323 A 323
            |
Human   399 A 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 37/133 (28%)
7tm_1 55..313 CDD:278431 82/299 (27%)
RXFP3NP_057652.1 7tm_1 98..389 CDD:278431 82/299 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.