DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R2 and Galr1

DIOPT Version :9

Sequence 1:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_037090.2 Gene:Galr1 / 50577 RGDID:2656 Length:346 Species:Rattus norvegicus


Alignment Length:316 Identity:112/316 - (35%)
Similarity:171/316 - (54%) Gaps:22/316 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FGVIAITGFFGNLLVILVVVFN--NNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYYWPYG 107
            ||:|...|..||.|||.|:..:  ...||||||.|:||:.|||.:::.||||.||.|.:..|..|
  Rat    39 FGLIFAMGVLGNSLVITVLARSKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLG 103

  Fly   108 RFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVVLVVSVP 172
            .|.|:.:.|...|:...||:||..||:||::|:||..||..:|.....|:.:..:|.:.:.::.|
  Rat   104 AFICKFIHYFFTVSMLVSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGFIWALSIAMASP 168

  Fly   173 VAFTHDVVVDYDAKKNITYGMCTFTTNDFLGPRTYQVTFFISSYLLPLMIISGLYMRMIMRLWRQ 237
            ||:...:   :....|.|:  |.....:.|..:.|.|..|:..|||||::|...|.:::..|.::
  Rat   169 VAYYQRL---FHRDSNQTF--CWEHWPNQLHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKK 228

  Fly   238 GTGVRMSKESQRGRKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKLVIQVTAQTLA 302
            ..  .|||:|:..:|:..:.|:|||:.|...|||..:|.|......... |......::||..||
  Rat   229 LK--NMSKKSEASKKKTAQTVLVVVVVFGISWLPHHVIHLWAEFGAFPL-TPASFFFRITAHCLA 290

  Fly   303 YSSSCINPLLYAFLSENFRKAFYKAVNC---------SSRYQNYTSDLPPPRKTSC 349
            ||:|.:||::|||||||||||:.:...|         .::.:| ..|.||  .|:|
  Rat   291 YSNSSVNPIIYAFLSENFRKAYKQVFKCRVCNESPHGDAKEKN-RIDTPP--STNC 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 48/118 (41%)
7tm_1 55..313 CDD:278431 90/259 (35%)
Galr1NP_037090.2 7tm_1 49..301 CDD:278431 90/259 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 326..346 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 179 1.000 Domainoid score I3436
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I3578
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1294084at2759
OrthoFinder 1 1.000 - - FOG0000972
OrthoInspector 1 1.000 - - mtm9131
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1132
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.