DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R2 and GALR1

DIOPT Version :9

Sequence 1:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001471.2 Gene:GALR1 / 2587 HGNCID:4132 Length:349 Species:Homo sapiens


Alignment Length:317 Identity:115/317 - (36%)
Similarity:172/317 - (54%) Gaps:22/317 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FGVIAITGFFGNLLVILVVVFN--NNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYYWPYG 107
            ||:|...|..||.|||.|:..:  ...||||||.|:||:.|||.:::.||||.||.|.:..|..|
Human    40 FGLIFALGVLGNSLVITVLARSKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLG 104

  Fly   108 RFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVVLVVSVP 172
            .|.|:.:.|...|:...||:||..||:||::|:||..||..:|.....|:.:..:|.:.:.::.|
Human   105 AFICKFIHYFFTVSMLVSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGCIWALSIAMASP 169

  Fly   173 VAFTHDVVVDYDAKKNITYGMCTFTTNDFLGPR---TYQVTFFISSYLLPLMIISGLYMRMIMRL 234
            ||: |..:....|...      ||....:..||   .|.|..|:..|||||::|...|.:::..|
Human   170 VAY-HQGLFHPRASNQ------TFCWEQWPDPRHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHL 227

  Fly   235 WRQGTGVRMSKESQRGRKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKLVIQVTAQ 299
            .::..  .|||:|:..:|:..:.|:|||:.|...|||..:|.|.....|... |....:.::||.
Human   228 HKKLK--NMSKKSEASKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPL-TPASFLFRITAH 289

  Fly   300 TLAYSSSCINPLLYAFLSENFRKAFYKAVNCSSRYQNYTSD-------LPPPRKTSC 349
            .||||:|.:||::|||||||||||:.:...|..|..::.||       :..|..|:|
Human   290 CLAYSNSSVNPIIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKESKSRIDTPPSTNC 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 48/118 (41%)
7tm_1 55..313 CDD:278431 93/262 (35%)
GALR1NP_001471.2 7tm_1 50..303 CDD:278431 93/262 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 176 1.000 Domainoid score I3617
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I3667
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1294084at2759
OrthoFinder 1 1.000 - - FOG0000972
OrthoInspector 1 1.000 - - mtm9822
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.