DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R2 and Mtnr1b

DIOPT Version :9

Sequence 1:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_663758.2 Gene:Mtnr1b / 244701 MGIID:2181726 Length:364 Species:Mus musculus


Alignment Length:317 Identity:81/317 - (25%)
Similarity:146/317 - (46%) Gaps:47/317 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 INGTLPWIVGFFFGVIAIT---GFFGNLLVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIPF 94
            :....||:......|:.:|   .|.|||||||.|:.|..:|:..||.:|:||.|||:..:...|.
Mouse    32 VTARAPWVAPMLSTVVVVTTAVDFVGNLLVILSVLRNRKLRNAGNLFVVSLALADLVIALYPYPL 96

  Fly    95 TATDYMVYYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAI 159
            .....:...|..|...|::..:::.::...|::.:..::|:|:..:.|......:.:...|.|.|
Mouse    97 ILVAIIRDGWVLGEAHCKASAFVMGLSVIGSVFNITAIAINRYCCICHSTTYHRVCSHWYTPIYI 161

  Fly   160 VTLWIVVLVVSVPVAFTHDVVVDYDAKKNITYGMCTFTTNDFLGPRTYQVTFFISS--------- 215
            ..:|::.||..||..|...  ::||                   ||.|..||..::         
Mouse   162 SLVWLLTLVALVPNFFVGS--LEYD-------------------PRIYSCTFIQTASTQYTAAVV 205

  Fly   216 ---YLLPLMIISGLYMRM-IMRLWRQGTGVRMSKESQRGRKRVTRL-----VVVVVIAFASLWLP 271
               :|||:.::|..|:|: ::.|..:    |.:|..::.|.|.:.|     :..|.:.||..|.|
Mouse   206 AIHFLLPMAVVSFCYLRIWVLVLQAR----RKAKAERKLRLRPSDLRSFLTMFAVFVVFAICWAP 266

  Fly   272 VQLILLLKSLDVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKAV 328
            :..|.|..:::...........:.||:..|||.:||:|.::|..|::|||:. ||.:
Mouse   267 LNCIGLAVAINPEAMALQVPEGLFVTSYFLAYFNSCLNAIVYGLLNQNFRRE-YKRI 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 32/119 (27%)
7tm_1 55..313 CDD:278431 69/275 (25%)
Mtnr1bNP_663758.2 7tm_4 55..>192 CDD:304433 41/157 (26%)
7tm_1 57..308 CDD:278431 69/275 (25%)
7tm_4 <131..>261 CDD:304433 32/154 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 343..364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6636
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.