DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R2 and Hcrtr1

DIOPT Version :10

Sequence 1:NP_524544.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_945197.2 Gene:Hcrtr1 / 230777 MGIID:2385650 Length:416 Species:Mus musculus


Alignment Length:96 Identity:21/96 - (21%)
Similarity:34/96 - (35%) Gaps:34/96 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SYVHTCAGSLITLKYVLTTAACLYRWVNEFGIEYSFVTLG-SLFNGDTQWEQRI------NFTDN 131
            :|:..|.|.:|       :|.||    ..||...:.|.:. :...|....:.||      :|..:
Mouse    74 AYIQVCRGLMI-------SAVCL----GFFGASLALVGMKCTRIGGSETTKARITCLCGLHFILS 127

  Fly   132 GI--------HTH--------PLYRYPSYEL 146
            ||        :.|        ||:....:||
Mouse   128 GICSITACSLYAHRITSEFFDPLFVKQKFEL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_524544.1 7tmA_AstA_R_insect 39..324 CDD:320224 21/96 (22%)
TM helix 1 40..66 CDD:320224
TM helix 2 73..99 CDD:320224 7/24 (29%)
TM helix 3 111..141 CDD:320224 9/52 (17%)
TM helix 4 153..173 CDD:320224
TM helix 5 204..233 CDD:320224
TM helix 6 249..279 CDD:320224
TM helix 7 292..317 CDD:320224
Hcrtr1NP_945197.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Required for response to orexin-A. /evidence=ECO:0000250|UniProtKB:O43613 26..41
7tmA_OXR 47..369 CDD:320336 21/96 (22%)
TM helix 1 48..74 CDD:320336 21/96 (22%)
TM helix 2 81..107 CDD:320336 8/36 (22%)
TM helix 3 119..149 CDD:320336 4/29 (14%)
TM helix 4 160..181 CDD:320336
TM helix 5 212..241 CDD:320336
TM helix 6 291..321 CDD:320336
TM helix 7 337..362 CDD:320336
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.