DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R2 and Uts2r

DIOPT Version :9

Sequence 1:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_663415.1 Gene:Uts2r / 217369 MGIID:2183450 Length:385 Species:Mus musculus


Alignment Length:348 Identity:97/348 - (27%)
Similarity:166/348 - (47%) Gaps:53/348 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENTT--MLA-------------NISLNATRNEENITSFFTDEEWLAINGTLPWIVGFFFGVIAI 50
            :|:|:  |||             |:|.|::.......|...|   |...|    ::|.....:.:
Mouse     5 LESTSFPMLAVSRSTASELPGGFNVSHNSSWTGPTDPSSLQD---LVATG----VIGAVLSTMGV 62

  Fly    51 TGFFGNLLVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYYWPYGRFWCRSVQ 115
            .|..||:..::|:.......::..:.:||||.|||:: :|.|||....|:...|.:|...||.:.
Mouse    63 VGVVGNVYTLVVMCRFLRASASMYVYVVNLALADLLY-LLSIPFIVATYVTKDWHFGDVGCRVLF 126

  Fly   116 YLIVVTAFASIYTLVLMSIDRFLAVVHPI----RSRMMRTENITLIAIVTLWIVVLVVSVPVAFT 176
            .|..:|..|||:||.:||.:|:.||:.|:    ||:..|    .|:|:.| |::.|::::|:...
Mouse   127 SLDFLTMHASIFTLTIMSSERYAAVLRPLDTVQRSKGYR----KLLALGT-WLLALLLTLPMMLA 186

  Fly   177 HDVVVDYDAKKNITYGMCTFTTNDFLGP---RTYQVTFFISSYLLPLMIISGLYMRMIMRLW--R 236
            ..:|      :..:..:|.    ...||   |||....|.:|.:.|.::|..||:|:....|  :
Mouse   187 IRLV------RRGSKSLCL----PAWGPRAHRTYLTLLFGTSIVGPGLVIGLLYIRLARAYWLSQ 241

  Fly   237 QGTGVRMSKESQR-GRKRVTRLVVVVVIAFASLWLPVQLILLLKSL-DVIETNTLTKLVIQVTAQ 299
            |.:    .|:::| ...||..|::.:|:.|.:.:||..|..||... ..:.....|..:|.....
Mouse   242 QAS----FKQTRRLPNPRVLYLILGIVLLFWACFLPFWLWQLLAQYHQAMPLTPETARIINYLTA 302

  Fly   300 TLAYSSSCINPLLYAFLSENFRK 322
            .|.|.:|||||.||..|::|:|:
Mouse   303 CLTYGNSCINPFLYTLLTKNYRE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 39/120 (33%)
7tm_1 55..313 CDD:278431 78/268 (29%)
Uts2rNP_663415.1 7tm_1 72..316 CDD:278431 76/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.