DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R2 and Nmur2

DIOPT Version :9

Sequence 1:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_694719.2 Gene:Nmur2 / 216749 MGIID:2441765 Length:395 Species:Mus musculus


Alignment Length:367 Identity:105/367 - (28%)
Similarity:173/367 - (47%) Gaps:41/367 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NATRNEENITSFF-TDEEWLAI-------NGTLPWIVGFFFGVIAITGFFGNLLVILVVVFNNNM 69
            ||:...:::..:. :.||:||.       :.:||  |...:.:|.:.|..|||||.||:..:..:
Mouse     6 NASWIHDSLMKYLNSTEEYLAYLCGPKRSDLSLP--VSVVYALIFVVGVIGNLLVCLVIARHQTL 68

  Fly    70 RSTTNLMIVNLAAADLMFVILCIPFTATD----YMVYYWPYGRFWCRSVQYLIVVTAFASIYTLV 130
            ::.||..:.:||.:||:.::|.:|....:    |...:.|.|   |.....|.....||||.::.
Mouse    69 KTPTNYYLFSLAVSDLLVLLLGMPLEVYELWHNYPFLFGPVG---CYFKTALFETVCFASILSVT 130

  Fly   131 LMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVVLVVSVPVAFTHDVVVDYDAKKNITYG--M 193
            .:||:|::|:|||.|:::..|....|..:..:|...:|.|:|....|.:........:...|  .
Mouse   131 TVSIERYVAIVHPFRAKLESTRRRALRILSLVWSFSVVFSLPNTSIHGIKFQQFPNGSSVPGSAT 195

  Fly   194 CTFTTNDFLGPRTYQVTFFISSYLLPLMIISGLYMRMIMRLWRQGTGVRMSKESQR--------G 250
            ||.|...::.....|.|.|: .|:||:.:||.||..|.:||.|.     .|.|:.:        .
Mouse   196 CTVTKPIWVYNFIIQATSFL-FYILPMTLISVLYYLMGLRLKRD-----ESLEADKVTVNIHRPS 254

  Fly   251 RKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKL--VIQVTAQTLAYSSSCINPLLY 313
            ||.||:::.|:|:.||..|.|..:..|..|.....|.:|..:  :|.|.:....|.||.:||::|
Mouse   255 RKSVTKMLFVLVLVFAICWTPFHVDRLFFSFVDEWTESLAAVFNLIHVVSGVFFYLSSAVNPIIY 319

  Fly   314 AFLSENFRKAFYKAV--NCSSRYQNYTSDLPPPRK----TSC 349
            ..||..||.||...|  :|...:..:....||.:|    |.|
Mouse   320 NLLSRRFRAAFRNVVSPSCKWCHPQHRPQGPPAQKVIFLTEC 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 36/120 (30%)
7tm_1 55..313 CDD:278431 80/273 (29%)
Nmur2NP_694719.2 7tm_4 48..333 CDD:304433 88/293 (30%)
7tm_1 54..319 CDD:278431 80/273 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.