DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R2 and Oprl1

DIOPT Version :10

Sequence 1:NP_524544.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001305848.1 Gene:Oprl1 / 18389 MGIID:97440 Length:396 Species:Mus musculus


Alignment Length:54 Identity:14/54 - (25%)
Similarity:23/54 - (42%) Gaps:10/54 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SPVTNPEHHISPIQEDGNWLDTYGYSAFEGQFPYHAEVRIKPISLSYVHTCAGS 82
            :||::|.|..||        ...|..|.|...|..:|:..  ...|::..|:|:
Mouse   308 NPVSSPTHAASP--------TVPGVVADEDSSPLPSELNC--THNSHITECSGN 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_524544.1 7tmA_AstA_R_insect 39..324 CDD:320224 10/44 (23%)
TM helix 1 40..66 CDD:320224 5/25 (20%)
TM helix 2 73..99 CDD:320224 3/10 (30%)
TM helix 3 111..141 CDD:320224
TM helix 4 153..173 CDD:320224
TM helix 5 204..233 CDD:320224
TM helix 6 249..279 CDD:320224
TM helix 7 292..317 CDD:320224
Oprl1NP_001305848.1 7tmA_NOFQ_opioid_R 49..327 CDD:320220 7/26 (27%)
TM helix 1 50..76 CDD:320220
TM helix 2 83..109 CDD:320220
TM helix 3 120..150 CDD:320220
TM helix 4 162..184 CDD:320220
TM helix 5 209..238 CDD:320220
TM helix 6 253..283 CDD:320220
TM helix 7 295..320 CDD:320220 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.