DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R2 and npr-35

DIOPT Version :10

Sequence 1:NP_524544.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001023088.2 Gene:npr-35 / 183681 WormBaseID:WBGene00016842 Length:384 Species:Caenorhabditis elegans


Alignment Length:32 Identity:12/32 - (37%)
Similarity:18/32 - (56%) Gaps:5/32 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 EMMEGTATGDSFVRGLKYLRNQ-VMSNKDCQR 209
            ||::.:|   |.:| .|:..|: |.||.|..|
 Worm    26 EMLKASA---SEIR-KKFEENRLVASNSDITR 53

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_524544.1 7tmA_AstA_R_insect 39..324 CDD:320224 12/32 (38%)
TM helix 1 40..66 CDD:320224
TM helix 2 73..99 CDD:320224
TM helix 3 111..141 CDD:320224
TM helix 4 153..173 CDD:320224
TM helix 5 204..233 CDD:320224 3/6 (50%)
TM helix 6 249..279 CDD:320224
TM helix 7 292..317 CDD:320224
npr-35NP_001023088.2 7tm_GPCRs 33..317 CDD:475119 9/22 (41%)
TM helix 1 35..59 CDD:410628 8/20 (40%)
TM helix 2 68..90 CDD:410628
TM helix 3 106..128 CDD:410628
TM helix 4 151..167 CDD:410628
TM helix 5 194..217 CDD:410628
TM helix 6 245..267 CDD:410628
TM helix 7 285..310 CDD:410628
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.