DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R2 and Ltb4r1

DIOPT Version :9

Sequence 1:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_032545.1 Gene:Ltb4r1 / 16995 MGIID:1309472 Length:351 Species:Mus musculus


Alignment Length:298 Identity:78/298 - (26%)
Similarity:136/298 - (45%) Gaps:53/298 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LPWIVGFFFGVIAITGFFGNLLVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMV 101
            ||.::   ..|....|..||..|:..::.....|:.|.|:::|||.|||. |:|..||.......
Mouse    22 LPIVL---LSVALAVGLPGNSFVVWSILKRMQKRTVTALLVLNLALADLA-VLLTAPFFLHFLAR 82

  Fly   102 YYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVV 166
            ..|.:....||...|:..::.:||:..:.:||:||.|||..|..|:.:||:......:..:|:|.
Mouse    83 GTWSFREMGCRLCHYVCGISMYASVLLITIMSLDRSLAVARPFMSQKVRTKAFARWVLAGIWVVS 147

  Fly   167 LVVSVPVAFTHDV---------VVDYDAKKNITYGMCTFTTNDFLGPRTYQVTF-FISSYLLPLM 221
            .::::||.....|         ..:|..|::                :.:.:.| .|:.:|||.:
Mouse   148 FLLAIPVLVYRTVKWNNRTLICAPNYPNKEH----------------KVFHLLFEAITGFLLPFL 196

  Fly   222 IISGLYMRMIMRLWRQGTGVRMSKESQRGRKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVI-- 284
            .:...|         ...|.|:.....|..:|..||||::::|||:.|||..|:.|:::...:  
Mouse   197 AVVASY---------SDIGRRLQARRFRRSRRTGRLVVLIILAFAAFWLPYHLVNLVEAGRTVAG 252

  Fly   285 -ETNT-------LTKLVIQVTAQTLAYSSSCINPLLYA 314
             :.|:       |.:.|:    ..||:.||.:||:|||
Mouse   253 WDKNSPAGQRLRLARYVL----IALAFLSSSVNPVLYA 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 35/116 (30%)
7tm_1 55..313 CDD:278431 71/277 (26%)
Ltb4r1NP_032545.1 7tm_1 37..285 CDD:278431 71/277 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837210
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.