DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R2 and si:dkey-148a17.5

DIOPT Version :9

Sequence 1:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001315622.1 Gene:si:dkey-148a17.5 / 100535037 ZFINID:ZDB-GENE-160728-121 Length:339 Species:Danio rerio


Alignment Length:323 Identity:82/323 - (25%)
Similarity:153/323 - (47%) Gaps:53/323 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TDEE---WLAINGTLPWIVGFFFGVIAITGFFGNLLVILVVVFNNNMRSTTNLMIVNLAAADLMF 87
            ||.|   |.....|...::   ..|..:.|..|||||:..::.:...||.|.|:|::|:.|||: 
Zfish    10 TDAEQDGWSTTGSTAACVI---LAVCFLVGTPGNLLVVWTILKHVKQRSHTVLLILHLSIADLL- 70

  Fly    88 VILCIPFTATDYMVY----YWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRM 148
            |::.:|.     .:|    .|.:|:..|:::.|:|....::|::.:.:||::||||:.:|.:...
Zfish    71 VLITLPL-----WIYSLARSWVFGKAACKAMVYIIYSCMYSSVFIITIMSVERFLAIRYPFKMLS 130

  Fly   149 MRTENITLIAIVTLWIVVLVVSVPVAFTHDVVVDYDAKKNITYGMCTFTTNDFLGPRTYQVTFF- 212
            .:.|......::..||:.|::..||..|..:..:.|..     |.|..        |.|....| 
Zfish   131 WKNETAMFRLLLVTWILSLLLGSPVILTQSLDDEDDGT-----GHCLH--------RVYNSLSFE 182

  Fly   213 --------ISSYLLPLMIISGLYMRMIMRLWRQGTGVRMSKESQRGRKRVTRLVVVVVIAFASLW 269
                    :..:::|...::..|.::..:|.:    ||.     |.:|:...|:..||:||...|
Zfish   183 VFCMCLETLLGFVIPFFTLAICYCQVAAQLRK----VRF-----RAKKKSVFLIGGVVVAFILCW 238

  Fly   270 LPVQLILLLKSLDVI-----ETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKA 327
            ||..::.::..:|::     |.:.::...|.:.. :||:.||.:||:||||.|..|..:..||
Zfish   239 LPHHVLNVISLVDILRGESEEASAISDSAIFIFG-SLAFISSSVNPVLYAFASRTFHGSLKKA 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 33/120 (28%)
7tm_1 55..313 CDD:278431 67/275 (24%)
si:dkey-148a17.5NP_001315622.1 7tm_4 33..276 CDD:304433 63/271 (23%)
7tm_1 39..286 CDD:278431 67/275 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.