DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AstA-R2 and kiss1rb

DIOPT Version :9

Sequence 1:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001104001.1 Gene:kiss1rb / 100002715 ZFINID:ZDB-GENE-060526-54 Length:364 Species:Danio rerio


Alignment Length:303 Identity:121/303 - (39%)
Similarity:180/303 - (59%) Gaps:26/303 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WIVGFFFGVIAITGFFGNLLVILVVVFNNNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYY 103
            |:|..||.:|...|..|||:||.||:.|..|::.|||.|||||..|::|::.|:|||||.|::..
Zfish    43 WLVPLFFTLIMFVGLVGNLIVIYVVIKNQQMKTVTNLYIVNLATTDILFLVCCVPFTATVYVLPS 107

  Fly   104 WPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVVLV 168
            |.:|.|.||.|.||..|||.|:..||..||:|||...|:|::|...||..:.|....|:||...:
Zfish   108 WIFGDFMCRLVNYLQQVTAQATCITLSAMSVDRFYVTVYPLQSLHHRTPQMALSVCTTIWICSSL 172

  Fly   169 VSVPVA-FTHDVVVDYDAKKNITYGMCTFTTNDF---LGPRTYQVTFFISSYLLPLMIISGLYMR 229
            :|||:| :.|       .:.:..:|..|:.|..|   :..|.|.:..|::.|||||:.|...|..
Zfish   173 LSVPIALYQH-------TESSYWFGPQTYCTETFPSVIHKRVYLLYSFLAVYLLPLITICMCYTF 230

  Fly   230 MIMRLWR------QGTG-VRMSKESQRG---RKRVTRLVVVVVIAFASLWLPVQLILLLKSL--- 281
            |:.|:.:      ||.. :.:...|:|.   |.||:|:|||:|:.|...|.|:|:::||::.   
Zfish   231 MLKRMAQATVQPVQGCNQISLQTSSERAEAVRSRVSRMVVVMVLLFLLCWGPIQILILLQAFCAE 295

  Fly   282 DVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAF 324
            ||..:.||.||  ::.|..::||:|.|||::|||:..||||||
Zfish   296 DVSRSYTLYKL--KIWAHGMSYSNSSINPVIYAFMGANFRKAF 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 54/116 (47%)
7tm_1 55..313 CDD:278431 106/274 (39%)
kiss1rbNP_001104001.1 7tm_1 59..325 CDD:278431 106/274 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 176 1.000 Domainoid score I3566
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1294084at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.