DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snu and CAF16

DIOPT Version :9

Sequence 1:NP_651628.1 Gene:snu / 43391 FlyBaseID:FBgn0039594 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_116625.1 Gene:CAF16 / 850516 SGDID:S000001866 Length:289 Species:Saccharomyces cerevisiae


Alignment Length:315 Identity:80/315 - (25%)
Similarity:140/315 - (44%) Gaps:60/315 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 TQAAVSVRHAFKAYGKKKNANQVLNNLNMTVPKGTIYGLLGASGCGKTTLLSCIVGRRYMDAGEI 134
            :|.|:.||:.  .|..|::::..:.::|:.:|..|...::||:|.||:|||..:.|:.....|:|
Yeast     3 SQFAIEVRNL--TYKFKESSDPSVVDINLQIPWNTRSLVVGANGAGKSTLLKLLSGKHLCLDGKI 65

  Fly   135 FVLGGKPGTRGSGVPGKRVGYMPQEI-ALYGEFSIQ-----ETMMYFG--W----IFGMD--TKE 185
            .|.|..|             :.|..: .:..:.|::     :|..|.|  |    |...|  ..|
Yeast    66 LVNGLDP-------------FSPLSMNQVDDDESVEDSTNYQTTTYLGTEWCHMSIINRDIGVLE 117

  Fly   186 ILERLQF---------LLNFLDLPSEKRLVKNLSGGQQRRVSFAVALMHDPELLILDEPTVGVDP 241
            :|:.:.|         |:..||:....|: ..||.||:|||..|:.|:....:|:|||.||.:|.
Yeast   118 LLKSIGFDHFRERGERLVRILDIDVRWRM-HRLSDGQKRRVQLAMGLLKPWRVLLLDEVTVDLDV 181

  Fly   242 LLRQSIWNHLVHITKAGQKTVIITTHYIEE-ARQAHTIGLMRSGHLLAEESPSVLLSIYKCISLE 305
            :.|..:...|...|:..:.:|:..||..:. |:..:.:..|:||.::..      |...|.:...
Yeast   182 IARARLLEFLKWETETRRCSVVYATHIFDGLAKWPNQVYHMKSGKIVDN------LDYQKDVEFS 240

  Fly   306 EVFLKLSRIQSQ-KGDVTHVNFSNNI------SLHAMAF-GSKMDKPSSSQEGGV 352
            ||      :.:: .|.|...|.:|.:      |||.:|. ..|.|.....:|.|:
Yeast   241 EV------VNAKVNGQVAFENDNNKVVISKVNSLHPLALEWLKRDNQIPDKEIGI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snuNP_651628.1 LolD 73..290 CDD:224059 63/240 (26%)
ABC_DR_subfamily_A 74..286 CDD:213197 62/235 (26%)
pip_yhgE_Nterm 427..>474 CDD:276270
ABC2_membrane_3 429..801 CDD:289468
ABC2_membrane 601..769 CDD:279410
CAF16NP_116625.1 COG4586 1..289 CDD:226952 79/313 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46598
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16705
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.