DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snu and Abca2

DIOPT Version :9

Sequence 1:NP_651628.1 Gene:snu / 43391 FlyBaseID:FBgn0039594 Length:808 Species:Drosophila melanogaster
Sequence 2:XP_006233707.2 Gene:Abca2 / 79248 RGDID:620238 Length:2435 Species:Rattus norvegicus


Alignment Length:335 Identity:86/335 - (25%)
Similarity:150/335 - (44%) Gaps:59/335 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PRNTQAAVSVRHAFKAYGKKKNANQVLNNLNMTVPKGTIYGLLGASGCGKTTLLSCIVGRRYMDA 131
            |.:....|.|....|.|  |.:....||.|::.:.:..:...||.:|.||||.:|.:.|.....:
  Rat   984 PTHLPLVVCVDKLTKVY--KNDKKLALNKLSLNLYENQVVSFLGHNGAGKTTTMSILTGLFPPTS 1046

  Fly   132 GEIFVLGGKPGTRGSGVPGKRVGYMPQEIALYGEFSIQETMMYFGWIFGMDTKEILERLQFLLNF 196
            |...:.|....|....: .|.:|..||...|:.:.:::|.:.::..:..|..:||.:.:..::..
  Rat  1047 GSATIYGHDIRTEMDEI-RKNLGMCPQHNVLFDQLTVEEHLWFYSRLKSMAQEEIRKEMDKMIED 1110

  Fly   197 LDLPSEKR--LVKNLSGGQQRRVSFAVALMHDPELLILDEPTVGVDPLLRQSIWNHLVHITKAGQ 259
            |:| |.||  ||:.||||.:|::|.|:|.:.....:||||||.||||..|::||: |:...|.| 
  Rat  1111 LEL-SNKRHSLVQTLSGGMKRKLSVAIAFVGGSRAIILDEPTAGVDPYARRAIWD-LILKYKPG- 1172

  Fly   260 KTVIITTHYIEEA-RQAHTIGLMRSGHLLAEESPSVLLSIYKCISLEEVFLKLSRIQSQKGDVTH 323
            :|::::||:::|| .....|.::..|.|....||..|...|                   ||.  
  Rat  1173 RTILLSTHHMDEADLLGDRIAIISHGKLKCCGSPLFLKGAY-------------------GDG-- 1216

  Fly   324 VNFSNNISLHAMAFGSKMDKPSSSQEGGVVG-------------------LNFHQSKEVLINDSN 369
                     :.:....:..:|.:|||.|:..                   :..|.:..:|::|::
  Rat  1217 ---------YRLTLVKRPAEPGTSQEPGMASSPSGRPQLSNCSEMQVSQFIRKHVASSLLVSDTS 1272

  Fly   370 GSI-YTLNQE 378
            ..: |.|..|
  Rat  1273 TELSYILPSE 1282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snuNP_651628.1 LolD 73..290 CDD:224059 68/219 (31%)
ABC_DR_subfamily_A 74..286 CDD:213197 67/214 (31%)
pip_yhgE_Nterm 427..>474 CDD:276270
ABC2_membrane_3 429..801 CDD:289468
ABC2_membrane 601..769 CDD:279410
Abca2XP_006233707.2 rim_protein 1..2369 CDD:130324 86/335 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.