DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snu and Abca8b

DIOPT Version :9

Sequence 1:NP_651628.1 Gene:snu / 43391 FlyBaseID:FBgn0039594 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_038879.2 Gene:Abca8b / 27404 MGIID:1351668 Length:1620 Species:Mus musculus


Alignment Length:233 Identity:76/233 - (32%)
Similarity:122/233 - (52%) Gaps:17/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 KKNANQVLNNLNMTVPKGTIYGLLGASGCGKTTLLSCIVGRRYMDAGEIFVLGGKPGTRGSGVPG 150
            ||.|.....|::..|.||.|.||||.:|.||:|.|..|.|...:.||::.:.|.:.|    ..||
Mouse  1297 KKKAKIATRNVSFCVRKGEILGLLGHNGAGKSTSLKMISGDTKVTAGQVLLKGSREG----DTPG 1357

  Fly   151 KRVGYMPQEIALYGEFSIQETMMYFGWIFGMDTKEILERLQFLLNFLDLPSE-KRLVKNLSGGQQ 214
             .:||.|||.||:...:::|.:..|..:.|:........:..|.:.|.|..: |..||.||.|.:
Mouse  1358 -FLGYCPQENALWPNLTVKEHLEIFAAVRGLRKSHAAVAITRLADALKLQDQLKSPVKTLSEGVK 1421

  Fly   215 RRVSFAVALMHDPELLILDEPTVGVDPLLRQSIWNHLVHITKAGQKTVIITTHYIEEARQ-AHTI 278
            |::.|.::::.:|.:|:||||:.|:||..:|.||..:..|.|...:..::||||:.||.. ...:
Mouse  1422 RKLCFVLSILGNPSILLLDEPSTGLDPEGQQQIWQAIRAIIKNTDRGALLTTHYMAEAEALCDRV 1486

  Fly   279 GLMRSG---------HLLAEESPSVLLSIYKCISLEEV 307
            .::.||         ||.::.....||.: |..:||:|
Mouse  1487 AILVSGRLRCIGSIQHLKSKFGKDYLLEM-KVKTLEQV 1523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snuNP_651628.1 LolD 73..290 CDD:224059 70/214 (33%)
ABC_DR_subfamily_A 74..286 CDD:213197 68/210 (32%)
pip_yhgE_Nterm 427..>474 CDD:276270
ABC2_membrane_3 429..801 CDD:289468
ABC2_membrane 601..769 CDD:279410
Abca8bNP_038879.2 rim_protein <265..1596 CDD:130324 76/233 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.