DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snu and caf16

DIOPT Version :9

Sequence 1:NP_651628.1 Gene:snu / 43391 FlyBaseID:FBgn0039594 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001343004.1 Gene:caf16 / 2541846 PomBaseID:SPAC20G4.01 Length:280 Species:Schizosaccharomyces pombe


Alignment Length:182 Identity:56/182 - (30%)
Similarity:91/182 - (50%) Gaps:15/182 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LNNLNMTVPKGTIYGLLGASGCGKTTLLSCIVGRRYMDAGEIFVLGGKPGTRGSGVPGKRVGYMP 157
            |:::.:.:|||:...|:||:|.||:|||..:.|:....||.|.| |||...|.|   .....|:.
pombe    20 LDHVTLDLPKGSRTLLVGANGAGKSTLLKLLSGKSLAKAGHISV-GGKDPFRES---SSAFVYLG 80

  Fly   158 QE----IALYGEFSIQETMMYFGWIFGMDTKEILERLQFLLNFLDLPSEKRLVKNLSGGQQRRVS 218
            .|    ..::.:.|:...:...|      ..:..||..||::.||:....|: ..:|.|::|||.
pombe    81 TEWVNNPVIHRDMSVARLIASVG------GDKFAERRDFLISILDIDLRWRM-HAVSDGERRRVQ 138

  Fly   219 FAVALMHDPELLILDEPTVGVDPLLRQSIWNHLVHITKAGQKTVIITTHYIE 270
            ..:.|:...|:|:|||.||.:|.|.|..:.|.|...|:....|::..||..:
pombe   139 LCMGLLRPFEVLLLDEVTVDLDVLARADLLNFLQEETEVRNATIVYATHIFD 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snuNP_651628.1 LolD 73..290 CDD:224059 56/182 (31%)
ABC_DR_subfamily_A 74..286 CDD:213197 56/182 (31%)
pip_yhgE_Nterm 427..>474 CDD:276270
ABC2_membrane_3 429..801 CDD:289468
ABC2_membrane 601..769 CDD:279410
caf16NP_001343004.1 COG4586 7..280 CDD:226952 56/182 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16705
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.