DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snu and ABCA4

DIOPT Version :9

Sequence 1:NP_651628.1 Gene:snu / 43391 FlyBaseID:FBgn0039594 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_000341.2 Gene:ABCA4 / 24 HGNCID:34 Length:2273 Species:Homo sapiens


Alignment Length:247 Identity:73/247 - (29%)
Similarity:130/247 - (52%) Gaps:7/247 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VSVRHAFKAYGKKKNANQVLNNLNMTVPKGTIYGLLGASGCGKTTLLSCIVGRRYMDAGEIFVLG 138
            |.|::..|.:  :......::.||:|..:..|...||.:|.||||.||.:.|.....:|.:.| |
Human   929 VCVKNLVKIF--EPCGRPAVDRLNITFYENQITAFLGHNGAGKTTTLSILTGLLPPTSGTVLV-G 990

  Fly   139 GKPGTRGSGVPGKRVGYMPQEIALYGEFSIQETMMYFGWIFGMDTKEILERLQFLLNFLDLPSEK 203
            |:..........:.:|..||...|:...::.|.|:::..:.|...:|....::.:|....|..::
Human   991 GRDIETSLDAVRQSLGMCPQHNILFHHLTVAEHMLFYAQLKGKSQEEAQLEMEAMLEDTGLHHKR 1055

  Fly   204 -RLVKNLSGGQQRRVSFAVALMHDPELLILDEPTVGVDPLLRQSIWNHLVHITKAGQKTVIITTH 267
             ...::||||.||::|.|:|.:.|.:::||||||.||||..|:|||:.|:.. ::| :|:|::||
Human  1056 NEEAQDLSGGMQRKLSVAIAFVGDAKVVILDEPTSGVDPYSRRSIWDLLLKY-RSG-RTIIMSTH 1118

  Fly   268 YIEEA-RQAHTIGLMRSGHLLAEESPSVLLSIYKCISLEEVFLKLSRIQSQK 318
            :::|| .....|.::..|.|....:|..|.:.:.......:..|:..||||:
Human  1119 HMDEADLLGDRIAIIAQGRLYCSGTPLFLKNCFGTGLYLTLVRKMKNIQSQR 1170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snuNP_651628.1 LolD 73..290 CDD:224059 66/217 (30%)
ABC_DR_subfamily_A 74..286 CDD:213197 65/213 (31%)
pip_yhgE_Nterm 427..>474 CDD:276270
ABC2_membrane_3 429..801 CDD:289468
ABC2_membrane 601..769 CDD:279410
ABCA4NP_000341.2 rim_protein 1..2272 CDD:130324 73/247 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 891..911
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1284..1345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.