DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snu and abca12

DIOPT Version :10

Sequence 1:NP_651628.1 Gene:snu / 43391 FlyBaseID:FBgn0039594 Length:808 Species:Drosophila melanogaster
Sequence 2:XP_031748843.1 Gene:abca12 / 101731410 XenbaseID:XB-GENE-6041943 Length:7516 Species:Xenopus tropicalis


Alignment Length:55 Identity:17/55 - (30%)
Similarity:24/55 - (43%) Gaps:6/55 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NNDSPDVQVTVK-DLPISFKVKYLGSQPAAGLWGIKHTRLPVDHLVSVAKNLPPN 86
            :..:|.:.|:.| |||....|    |.|:...:..|| |||.....|.|....|:
 Frog   293 DGQTPCLFVSSKADLPEGVAV----SGPSPAEFCRKH-RLPAPVPFSCAGPAEPS 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snuNP_651628.1 CcmA 74..311 CDD:440746 3/13 (23%)
YadH 609..807 CDD:440604
abca12XP_031748843.1 rim_protein 4..>82 CDD:130324
rim_protein 5675..7493 CDD:130324
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.