DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sid and XB5812267

DIOPT Version :9

Sequence 1:NP_651627.1 Gene:Sid / 43390 FlyBaseID:FBgn0039593 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001072816.1 Gene:XB5812267 / 780277 XenbaseID:XB-GENE-5812268 Length:297 Species:Xenopus tropicalis


Alignment Length:119 Identity:32/119 - (26%)
Similarity:47/119 - (39%) Gaps:33/119 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 FDRGHMTPASAFISTELKKSTFRYLNAIPQYRGVNRGKWKAVE------------TWVNNMVRGL 244
            :.|||:.|.....:...:.:||...||:|...|.|:|||:..|            |:|   |.|:
 Frog   151 YHRGHLNPVCHHETKAAQDATFTLTNAVPMVSGFNQGKWRVHEKRMIEETKDCNITYV---VTGI 212

  Fly   245 Y--DNPIINNVQIPRTYDVLKVCIGALGVHRLRHNTNNNMIPI----YLLDNNK 292
            .  :|.:.|.|.||........|:            |||..|:    .|.:|.|
 Frog   213 IPGNNRLNNRVNIPSRVWSAYCCV------------NNNGKPVKSGAVLAENTK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidNP_651627.1 Endonuclease_NS 106..358 CDD:279553 32/119 (27%)
XB5812267NP_001072816.1 Endonuclease_NS 65..271 CDD:214889 32/119 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556753at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.