Sequence 1: | NP_651627.1 | Gene: | Sid / 43390 | FlyBaseID: | FBgn0039593 | Length: | 370 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001104647.1 | Gene: | zgc:172339 / 564384 | ZFINID: | ZDB-GENE-080204-115 | Length: | 288 | Species: | Danio rerio |
Alignment Length: | 261 | Identity: | 61/261 - (23%) |
---|---|---|---|
Similarity: | 86/261 - (32%) | Gaps: | 91/261 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 117 FNG--RFMELYRNCFDGYSLAFQHSIYKAYRYVNT-------VP---RPNPTWQSD--------- 160
Fly 161 QLSGGFDNAYEGRATQACLLTNLGAVQPQCKFDRGHMTPASAFISTELKKSTFRYLNAIPQYRGV 225
Fly 226 NRGKWK----AVETWVNNMVRGLYDNPIINNVQIPRTYDVLKVCIGALGVHRLRHNTNNNMIPIY 286
Fly 287 L--------LDNN-------KIP-----------VPEWMYKIVSHLSG--------DKWVMLTYN 317
Fly 318 D 318 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sid | NP_651627.1 | Endonuclease_NS | 106..358 | CDD:279553 | 61/261 (23%) |
zgc:172339 | NP_001104647.1 | Endonuclease_NS | 58..268 | CDD:214889 | 55/241 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 40 | 1.000 | Domainoid score | I12511 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D556753at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |