DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sid and zgc:172339

DIOPT Version :9

Sequence 1:NP_651627.1 Gene:Sid / 43390 FlyBaseID:FBgn0039593 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001104647.1 Gene:zgc:172339 / 564384 ZFINID:ZDB-GENE-080204-115 Length:288 Species:Danio rerio


Alignment Length:261 Identity:61/261 - (23%)
Similarity:86/261 - (32%) Gaps:91/261 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 FNG--RFMELYRNCFDGYSLAFQHSIYKAYRYVNT-------VP---RPNPTWQSD--------- 160
            :||  |::.|       |.:.....:|.||.:..:       ||   .|..:..||         
Zfish    55 YNGKPRYVTL-------YDVVDHIPVYSAYTFKRSDGSKKVDVPWMFEPQLSTTSDSGEMQAFPP 112

  Fly   161 QLSGGFDNAYEGRATQACLLTNLGAVQPQCKFDRGHMTPASAFISTELKKSTFRYLNAIPQYRGV 225
            .:.|.|.:      |||.|......|:    |:|||:.|.......:.|.:|:...|.:||.|..
Zfish   113 NVHGSFSD------TQAVLEDYSNIVE----FERGHLNPDEHQAHPDDKAATYTLTNVVPQVREF 167

  Fly   226 NRGKWK----AVETWVNNMVRGLYDNPIINNVQIPRTYDVLKVCIGALGVHRLRHNTNNNMIPIY 286
            |.|.||    .:...:||..||             ..|.|..|......:.  |:|.|...:|.|
Zfish   168 NIGHWKRHEHIIRRRLNNYCRG-------------TAYIVTGVTTSGRMIR--RYNINRVAVPTY 217

  Fly   287 L--------LDNN-------KIP-----------VPEWMYKIVSHLSG--------DKWVMLTYN 317
            |        .|:|       |.|           |||.:...|..|..        ||...|.|.
Zfish   218 LWSAYCCVDYDHNAPFDERSKFPAYASHGLNEKEVPEVIEMSVQQLEDFLKRNTFVDKKFQLFYE 282

  Fly   318 D 318
            :
Zfish   283 N 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidNP_651627.1 Endonuclease_NS 106..358 CDD:279553 61/261 (23%)
zgc:172339NP_001104647.1 Endonuclease_NS 58..268 CDD:214889 55/241 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12511
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556753at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.