DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sid and si:ch211-133n4.4

DIOPT Version :9

Sequence 1:NP_651627.1 Gene:Sid / 43390 FlyBaseID:FBgn0039593 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001070844.1 Gene:si:ch211-133n4.4 / 559260 ZFINID:ZDB-GENE-030131-898 Length:266 Species:Danio rerio


Alignment Length:280 Identity:58/280 - (20%)
Similarity:92/280 - (32%) Gaps:106/280 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SIPSATFAVGFSF-NGRFMELYRNCFDGY--------------SLAFQHSIYK--------AYRY 146
            ||.||....||.| ....::.:..|...:              |.|...:.||        |.|:
Zfish     4 SIVSALLLFGFPFIKTDVVDSFSKCSQFFLEGKPPVIPDILKDSAAQNSNRYKLICQQYQNAVRF 68

  Fly   147 VNTVPRPN--PTWQSDQLSGGFDNAYEGRATQACLLTNLGAVQPQCKFD--------------RG 195
            .......|  ||:.:.:.:|      :|..|:.   .:...::|:.|.|              ||
Zfish    69 ATLYDTTNKIPTFSAYKYTG------KGNFTKP---HSRFRIEPELKDDQAKNSDYRNNIQMTRG 124

  Fly   196 HMTPASAFISTELKKSTFRYLNAIPQYRGVNRGKWKAVETWVNNMVRGLYDNPIINNVQIPRTYD 260
            |:.|:...:..:..||||...||:||.:..|...|                |...||        
Zfish   125 HLFPSGHAVDLDTAKSTFTLTNAVPQEKTFNEVTW----------------NQKKNN-------- 165

  Fly   261 VLKVCIGALGVHRLRHNTNNNMIPIYLLDNNKIPVPEWMYKIVSHLSGDKWVMLTYND-VSLPNQ 324
                         .:.:.:||.|.:    |||:..    |.:...:.|||    ..|| |::|:.
Zfish   166 -------------FKTHMDNNCINV----NNKVEA----YVVTGVIPGDK----KLNDKVNIPSH 205

  Fly   325 QALNQICHVIPCHPGLNLNT 344
            ..:...|:        |.||
Zfish   206 MWMAYCCY--------NKNT 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidNP_651627.1 Endonuclease_NS 106..358 CDD:279553 57/279 (20%)
si:ch211-133n4.4NP_001070844.1 Endonuclease_NS 67..225 CDD:214889 45/217 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12511
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556753at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.