DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sid and CG3819

DIOPT Version :9

Sequence 1:NP_651627.1 Gene:Sid / 43390 FlyBaseID:FBgn0039593 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001262027.1 Gene:CG3819 / 40069 FlyBaseID:FBgn0036833 Length:423 Species:Drosophila melanogaster


Alignment Length:360 Identity:88/360 - (24%)
Similarity:131/360 - (36%) Gaps:104/360 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NNGVYDIQRSDIVEIHQTLYLL-----------CNGGLHRTTFLC---RYDSVFSPALSSAACAP 91
            :.|..|:.:...:|.|.|..|.           |.||   |||..   .:|      ||:..|..
  Fly    77 DTGYVDVDKDKTIEFHCTSSLASPLSGKSVTAKCVGG---TTFKIDDKEHD------LSAIKCTS 132

  Fly    92 PDPVVVKVPDTSCSIPSATFAVGFSFNG-RFMELYRNCFDGYSLAFQHSIYKAYRYVNTVPRPNP 155
            ....|.|...:||:..:....|||..:| ||...|..||        :...:..|||.....|..
  Fly   133 WPVFVGKKSGSSCNGGTTLIKVGFELSGSRFATQYEVCF--------NEDEEVTRYVYHRLEPGN 189

  Fly   156 TWQS---DQLSGGFDNAYEGRATQACLLTNLGAVQPQC-----------KFD--------RGHMT 198
            .:.:   |:::.|....:.|:.... |.|.  |||.:.           .||        ||||.
  Fly   190 NYYATGVDRITFGAGGYFAGKNVDK-LYTQ--AVQKETIDKELDMDSSRFFDSAKNIFLARGHMG 251

  Fly   199 PASAFISTELKKSTFRYLNAIPQYRGVNRGKWKAVE----TWVNNMVRGLYDNPIINNVQIPRTY 259
            ..:.|:....:::||.::||.||::..|.|.|..||    .||..      :|..:.        
  Fly   252 AKADFVFAPEQRATFLFINAAPQWQTFNAGNWARVEDGVRAWVAK------ENKHVE-------- 302

  Fly   260 DVLKVC-IGALGVHRLRHNTNNNMIPIYLL-DNN---KIPVPEWMYKIVSHLSGDKWVMLTYNDV 319
                 | .|..||..| .|.|.....:||. |||   .||||:..:::|...|..|.::|    :
  Fly   303 -----CWTGVWGVTTL-PNKNGEQRQLYLSHDNNGNGLIPVPKLYFRVVIEPSTKKGIVL----I 357

  Fly   320 SLPNQQALNQICHVIPCHPGLNLNTKDVGHTVCCD 354
            .:.|              |.|:|......:.:|.|
  Fly   358 GVNN--------------PHLSLEEIKRDYILCTD 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidNP_651627.1 Endonuclease_NS 106..358 CDD:279553 68/281 (24%)
CG3819NP_001262027.1 NUC 164..415 CDD:238043 62/264 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450460
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.