DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sid and Tengl1

DIOPT Version :9

Sequence 1:NP_651627.1 Gene:Sid / 43390 FlyBaseID:FBgn0039593 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_722780.1 Gene:Tengl1 / 318883 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster


Alignment Length:164 Identity:35/164 - (21%)
Similarity:61/164 - (37%) Gaps:51/164 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 DRGHMTPASAFISTELKKSTF-----RYLNAIPQYRGVNRGKWKAVETWVNNMVR---GLYDNPI 249
            |...:.||.||..:|..:..|     .:||     ||.|...|..:..:|:.|.:   .:|  ..
  Fly   127 DSTSVAPAGAFGQSEAARVFFLSNIRPFLN-----RGFNLTVWDRLLQYVHEMSQRHGTVY--AY 184

  Fly   250 INNVQIPRTYDVLKVCIGALGVHRLRHNTNNNMIPIYLLDNNKIPVPEWMYKIV---SHLSGDKW 311
            ..::.:||.   ||              :|:..:.....:...:.||...:||:   ...:||  
  Fly   185 TGSIYLPRE---LK--------------SNSWFLEFQSEERTMVAVPTHFFKILVIDKKFAGD-- 230

  Fly   312 VMLTYNDVSLPNQQALNQICHVIPCHPGLNLNTK 345
                    ::|..:|     :|:|..| ||.|.:
  Fly   231 --------TIPYAEA-----YVMPNSP-LNNNVE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidNP_651627.1 Endonuclease_NS 106..358 CDD:279553 35/164 (21%)
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 35/164 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.