DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sid and Tengl2

DIOPT Version :9

Sequence 1:NP_651627.1 Gene:Sid / 43390 FlyBaseID:FBgn0039593 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster


Alignment Length:173 Identity:41/173 - (23%)
Similarity:63/173 - (36%) Gaps:49/173 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 FDRGHMTPA-SAFISTELKKSTFRYLNAIPQY-RGVNRGKWKAVETWVNNMVRGLYDNPIINNVQ 254
            |||||:..| :..:.....:.||...|..||. :|.||..|..:|.:|.|:|             
  Fly   149 FDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQYVRNLV------------- 200

  Fly   255 IPRTYDVLKVCIGALGVHRLRHNTNNN-----MIPIYLLDNNKIPVPEWMYKIV---SHLSGDKW 311
              ..:..:.||.|.|      :..|..     .:...::..|.:.||...:|::   |.|...|.
  Fly   201 --HRFGSVFVCTGPL------YKPNQRPGGKWAVEYEMIGLNMVAVPTHFFKVIMVESKLHLGKP 257

  Fly   312 VMLTYNDVSLPNQQALNQICHVIPCHPGLNLNT-----KDVGH 349
            .|..|   .|||          .|...||.|.:     :::.|
  Fly   258 YMEGY---VLPN----------APIPDGLPLRSFLCDIREIEH 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidNP_651627.1 Endonuclease_NS 106..358 CDD:279553 41/173 (24%)
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 41/173 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.