DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sid and Exog

DIOPT Version :9

Sequence 1:NP_651627.1 Gene:Sid / 43390 FlyBaseID:FBgn0039593 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_006244150.2 Gene:Exog / 301062 RGDID:1304628 Length:443 Species:Rattus norvegicus


Alignment Length:315 Identity:64/315 - (20%)
Similarity:100/315 - (31%) Gaps:112/315 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VYLSQNNGVYDIQ--RSDIVEIHQTLYLLCNG--GLHRTTFLCRYDSVFSPALS----------S 86
            |..:||:|...::  ...:.|:.:  :||..|  |..|:    |.|....|..|          :
  Rat    58 VLAAQNHGCKGLRFASQGLAEVSE--WLLGRGCSGRRRS----RADGAAVPPASGRGVREAGEAA 116

  Fly    87 AACAPPDPVVVKVPDTSCSIPSATFAV----GFSFNGRFMELYRNCFDGYSLAFQHSIYKAYRYV 147
            |.|:       .||.|..:..|....|    ||...|.....|.|          |::  :|...
  Rat   117 ARCS-------TVPGTELAFKSVEKVVLEQFGFPLTGTETRRYTN----------HAL--SYDQA 162

  Fly   148 NTVPRPNPTW-----QSDQLSGGFDNAYEGRATQACLLTNLGAVQPQCKF--------------- 192
            ..|||    |     ..|::.|..|..:                   |||               
  Rat   163 KRVPR----WVLEHISKDKIIGDADRKH-------------------CKFKPDPTVPSAFSALNE 204

  Fly   193 -------DRGHMTPA-SAFISTELKKSTFRYLNAIPQYRGVNRGKWKAVETWVNNMVRGLYDNPI 249
                   .||||.|| :...|:|....||...|.:||....|.|.|..:|.:...:.....|..|
  Rat   205 DYIGSGWSRGHMAPAGNNKFSSEAMAETFYLSNIVPQNFENNSGYWNRIEMYCRELTERFEDVWI 269

  Fly   250 INN-VQIPRTYDVLKVCIGALGVHRLRHNTNNNMIPIYLLDNNKIPVPEWMYKIV 303
            ::. :.:|.|                 .|.....:...::..:.:.||..:||::
  Rat   270 VSGPLTLPHT-----------------RNDGTKTVSYQVIGEDNVAVPSHLYKVI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidNP_651627.1 Endonuclease_NS 106..358 CDD:279553 45/231 (19%)
ExogXP_006244150.2 NUC 152..361 CDD:214683 40/208 (19%)
Exog_C 377..425 CDD:407864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341978
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.