DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sid and Exog

DIOPT Version :9

Sequence 1:NP_651627.1 Gene:Sid / 43390 FlyBaseID:FBgn0039593 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_766044.1 Gene:Exog / 208194 MGIID:2143333 Length:368 Species:Mus musculus


Alignment Length:229 Identity:47/229 - (20%)
Similarity:71/229 - (31%) Gaps:85/229 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 SATFAV----GFSFNGRFMELYRNCFDGYSLAFQHSIYKAYRYVNTVPRPNPTW-----QSDQLS 163
            ||..||    ||...|.....|.|          |::  :|.....|||    |     ..|::.
Mouse    56 SAEEAVLEQFGFPLAGTETRRYTN----------HAL--SYDQAKRVPR----WVLEHISKDKII 104

  Fly   164 GGFDNAYEGRATQACLLTNLGAVQPQCKF----------------------DRGHMTPA-SAFIS 205
            |..|..:                   |||                      .||||.|| :...|
Mouse   105 GDADRKH-------------------CKFKPDPSVPSAFSALNEDYIGSGWSRGHMAPAGNNKFS 150

  Fly   206 TELKKSTFRYLNAIPQYRGVNRGKWKAVETWVNNMVRGLYDNPIINN-VQIPRTYDVLKVCIGAL 269
            :|....||...|.:||....|.|.|..:|.:...:.....|..|::. :.:|.|           
Mouse   151 SEAMAETFYLSNIVPQNFDNNSGYWNRIEMYCRELTERFEDVWIVSGPLTLPHT----------- 204

  Fly   270 GVHRLRHNTNNNMIPIYLLDNNKIPVPEWMYKIV 303
                  .|.....:...::..:.:.||..:||::
Mouse   205 ------RNDGTKTVSYQVIGEDNVAVPSHLYKVI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidNP_651627.1 Endonuclease_NS 106..358 CDD:279553 47/229 (21%)
ExogNP_766044.1 NUC 77..287 CDD:214683 40/208 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.