DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sid and Endog

DIOPT Version :9

Sequence 1:NP_651627.1 Gene:Sid / 43390 FlyBaseID:FBgn0039593 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_031957.1 Gene:Endog / 13804 MGIID:1261433 Length:294 Species:Mus musculus


Alignment Length:134 Identity:34/134 - (25%)
Similarity:56/134 - (41%) Gaps:21/134 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 FDRGHMTPASAF-ISTELKKSTFRYLNAIPQYRGVNRGKWKAVETWVNNMVRGLYDNPIINNVQI 255
            |||||:..|:.. .|......||...|..||...:|:..|       ||:.|  |..      .:
Mouse   134 FDRGHLAAAANHRWSQRAMDDTFYLSNVAPQVPHLNQNAW-------NNLER--YSR------SL 183

  Fly   256 PRTYDVLKVCIGALGVHRLRHNTNNNMIPIYLLDNNKIPVPEWMYKI-VSHLSGDKWVMLTYNDV 319
            .|||..:.||.|.|.:.|...: ..:.:...::..|.:.||...:|: :...:|.:..:.:|   
Mouse   184 TRTYQNVYVCTGPLFLPRTEAD-GKSYVKYQVIGKNHVAVPTHFFKVLILEAAGGQIELRSY--- 244

  Fly   320 SLPN 323
            .:||
Mouse   245 VMPN 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidNP_651627.1 Endonuclease_NS 106..358 CDD:279553 34/134 (25%)
EndogNP_031957.1 NUC1 29..278 CDD:224777 34/134 (25%)
NUC 75..281 CDD:214683 34/134 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.