DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sid and LOC103910196

DIOPT Version :9

Sequence 1:NP_651627.1 Gene:Sid / 43390 FlyBaseID:FBgn0039593 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_017210189.1 Gene:LOC103910196 / 103910196 -ID:- Length:410 Species:Danio rerio


Alignment Length:121 Identity:24/121 - (19%)
Similarity:44/121 - (36%) Gaps:31/121 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 FDRGHMTPASAF-ISTELKKSTFRYLNAIPQYRGVNRGKWKAVETWVNNMVRG------LYDNPI 249
            :.:||:..|... ...|....||.:.|..||...:|......:|.......:.      :|..|:
Zfish   220 YTQGHLAAAGNHGWCQEAYNETFLFSNISPQSAKLNNSMMTVLEDSCRAKAKDQNCNIHIYTGPV 284

  Fly   250 INNVQ------------IPRTYDVLKVCIGALGVHRLRHNTNNNMIPI--YLLDNN 291
            |::.|            :|.::  .||.:        :.|.:..::|.  ||:.||
Zfish   285 ISDPQYVNQTSSSLQKAVPHSF--FKVIV--------QENHDGTILPPIGYLITNN 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidNP_651627.1 Endonuclease_NS 106..358 CDD:279553 24/121 (20%)
LOC103910196XP_017210189.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.