DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sid and wu:fd46g04

DIOPT Version :9

Sequence 1:NP_651627.1 Gene:Sid / 43390 FlyBaseID:FBgn0039593 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001373712.1 Gene:wu:fd46g04 / 103909050 ZFINID:ZDB-GENE-030131-4651 Length:272 Species:Danio rerio


Alignment Length:200 Identity:43/200 - (21%)
Similarity:70/200 - (35%) Gaps:55/200 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 YSLAFQHSIYKAYRYVNTVPRPNPTWQSDQLSGGFDNAY-----EGRATQACL------LTNLGA 185
            ||..::..||.||            |...:.:|..|..|     :|. .:.|:      :.|..|
Zfish    66 YSTTWKIPIYSAY------------WFGKESTGRCDVWYIEPQLDGE-NEPCMRPKGSKIKNNQA 117

  Fly   186 VQPQCK---FDRGHMTPASAFISTELKKSTFRYLNAIPQYRGVNRGKWKAVETWVNNMVRGLYDN 247
            |....|   :|:||:.|.....:.....:|....||.||....|:..||.            ::.
Zfish   118 VSSDYKNSGYDKGHVYPVMHTYNHLAMLATSTLTNAAPQKSKFNKEDWKE------------HEK 170

  Fly   248 PIINNVQIPRTYDVLKVCIGALGVHRLRHNTNNNMIPIYLLDNNKIPVPEWMYKIVSHL-SGDKW 311
            .:|.:         |..|..|..|..:..:|....:      ||||.|.::.::....| |.|.:
Zfish   171 AVIKD---------LASCKKAYVVAGVAPDTTAAKV------NNKITVSKFFWRATCCLNSNDVY 220

  Fly   312 VMLTY 316
            :...|
Zfish   221 IGKAY 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidNP_651627.1 Endonuclease_NS 106..358 CDD:279553 42/199 (21%)
wu:fd46g04NP_001373712.1 Endonuclease_NS 62..260 CDD:214889 42/199 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556753at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.