DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sid and si:dkey-243k1.3

DIOPT Version :9

Sequence 1:NP_651627.1 Gene:Sid / 43390 FlyBaseID:FBgn0039593 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001373225.1 Gene:si:dkey-243k1.3 / 100537487 ZFINID:ZDB-GENE-131121-191 Length:283 Species:Danio rerio


Alignment Length:226 Identity:48/226 - (21%)
Similarity:88/226 - (38%) Gaps:65/226 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 KVPDTSCSIPSATFAVGFSFNGRFMELYR--NCFDGYSLAFQHSIYKAY------------RYVN 148
            |:||.....|:..     ....||:..|.  ..:|.|   .:.::|.||            |:..
Zfish    40 KIPDLGAFQPNLV-----RICQRFLNTYHFATLYDTY---HRIAVYSAYIFEPSSGGGREKRWFV 96

  Fly   149 TVPRPNPTWQSD-----QLSGGFDNAYEGRATQACL--LTNLGAVQPQCKFDRGHMTPASAFIST 206
            .....:|.|.::     :||....:.|.|. .||..  .||.|       |||||:.| :...:.
Zfish    97 EPQLVSPAWSTEMEDGYKLSQQNPDIYLGE-KQALNEDYTNSG-------FDRGHLNP-NGHHAV 152

  Fly   207 ELKKSTFRYLNAIPQYRGVNRGKWKAVETWVNNMVRGLYDNPIINNVQIPRTYDVLKVCIGALGV 271
            ..:.:||...|.:||...:|:..|...|:.:.::.:          ....:.|    |.:||:  
Zfish   153 PSRNATFTLTNVVPQNPTLNQNAWNKHESKLTSLFK----------ANCHQAY----VLVGAI-- 201

  Fly   272 HRLRHNTNNNMIPIYLLDNN--KIPVPEWMY 300
                 .::||    :::.||  ::.:||:::
Zfish   202 -----PSSNN----WIIKNNVKRVNIPEYLW 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidNP_651627.1 Endonuclease_NS 106..358 CDD:279553 45/218 (21%)
si:dkey-243k1.3NP_001373225.1 Endonuclease_NS 62..263 CDD:214889 42/199 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12511
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556753at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.