DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sid and XB5738616

DIOPT Version :9

Sequence 1:NP_651627.1 Gene:Sid / 43390 FlyBaseID:FBgn0039593 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_012814850.1 Gene:XB5738616 / 100490587 XenbaseID:XB-GENE-5738617 Length:314 Species:Xenopus tropicalis


Alignment Length:133 Identity:31/133 - (23%)
Similarity:46/133 - (34%) Gaps:50/133 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 FDRGHMTPASAFISTELKKSTFRYLNAIPQYRGVNRGKWKAVE---------------------- 234
            :||||:.|....:..:.:.:||.:.|.:|..:|:|.|.|...|                      
 Frog   178 YDRGHLNPRGHHVDADKQNATFTFTNVVPMNKGLNNGNWNRYERRMMGNADGCTTMYVVTGIVPG 242

  Fly   235 -TWVNNMVRGLYDNPIINNVQIPRTYDVLKVCIGALGVHRLRHNTNNNMIPIY----LLDNNKIP 294
             .|:||           |.|.||........|:            :||..||.    |::|.|..
 Frog   243 NNWINN-----------NRVNIPSHVWSAYCCV------------DNNAKPIRSGAGLVNNTKDM 284

  Fly   295 VPE 297
            |.|
 Frog   285 VYE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidNP_651627.1 Endonuclease_NS 106..358 CDD:279553 31/133 (23%)
XB5738616XP_012814850.1 Endonuclease_NS 78..311 CDD:214889 31/133 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556753at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.