DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sid and si:dkey-85k7.10

DIOPT Version :9

Sequence 1:NP_651627.1 Gene:Sid / 43390 FlyBaseID:FBgn0039593 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_021333817.1 Gene:si:dkey-85k7.10 / 100004057 ZFINID:ZDB-GENE-160728-49 Length:299 Species:Danio rerio


Alignment Length:340 Identity:64/340 - (18%)
Similarity:113/340 - (33%) Gaps:94/340 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LYFFVGSVQANCLIDLAHLN--ANYVYLSQNNGVYDIQRSDIVEIHQTLYLLCNGGLHRTTFLCR 75
            |.|.:...||:.:.|.:.:.  .:::||......|         :..:|..:|...:.:..|:..
Zfish    15 LMFLILRSQASVVDDFSQVQRCKDFLYLGTPPRGY---------LSTSLKKICQRYVDQPRFITF 70

  Fly    76 YDSVFSPALSSAACAPPDPVVVKVPDTSCSIPSATFAVGFSFNGRFMELYRNCFDGYSLAFQHSI 140
            ||......:.||       .:.|..|....:.     |.:.|..:|.:|...  .|.|       
Zfish    71 YDPKKHIPMYSA-------YIFKKSDGEKRVD-----VPWMFEPQFAQLATE--KGSS------- 114

  Fly   141 YKAYRYVNTVPRPNPTWQSDQLSGGFDNAYEGRATQACLLTNLGAVQPQCKFDRGHMTPASAFIS 205
                   |..|.|    ||..:...|::      |||.|......||    ::||.:.|......
Zfish   115 -------NMEPFP----QSTFMHKNFED------TQAVLEDYADVVQ----YERGQLNPDEHQAD 158

  Fly   206 TELKKSTFRYLNAIPQYRGVNRGKW----KAVETWVNNMVRG-------------LYDNPIINNV 253
            ...|.:|:...|.:|..|..:.|.|    :.:...:||...|             :.....::.|
Zfish   159 PLDKAATYTLTNVVPLIREFSFGPWSTQVEVIRKRLNNYCHGKAHVITGVTTSGNMIRRENLDRV 223

  Fly   254 QIPRTYDVLKVC--------------IGALGVHRLRHNTNNNMIPIYLLDNNKIPVPEWMYKIV- 303
            .||........|              ..|.|.:.|....||:::        ::|: :::.|.: 
Zfish   224 AIPEFMWTAYCCTDYDHNAPYSERYKFPAFGAYGLNDRVNNHIV--------EVPI-KYLEKFLK 279

  Fly   304 SHLSGDKWVMLTYND 318
            ..:..||...:.|||
Zfish   280 GKMEVDKNFQIFYND 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidNP_651627.1 Endonuclease_NS 106..358 CDD:279553 47/245 (19%)
si:dkey-85k7.10XP_021333817.1 Endonuclease_NS 66..276 CDD:214889 48/260 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556753at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.