DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sid and LOC100002544

DIOPT Version :9

Sequence 1:NP_651627.1 Gene:Sid / 43390 FlyBaseID:FBgn0039593 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_001920405.3 Gene:LOC100002544 / 100002544 -ID:- Length:336 Species:Danio rerio


Alignment Length:285 Identity:60/285 - (21%)
Similarity:96/285 - (33%) Gaps:91/285 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PP----DPVVVKVPDTSCSIPSATFAVGFSFNGRFMELYRNCFDGYSLAFQHSIYKAYRYVNTV- 150
            ||    ||.:.|:.......|            ||:.|       |....:..:|.||.:..|. 
Zfish    76 PPRGFKDPSLKKICQRYADKP------------RFVTL-------YDPKIRIPVYSAYSFKKTEG 121

  Fly   151 -PRPNPTW----QSDQLSGG-----FDNAY---EGRATQACLLTNLGAVQPQCKFDRGHMTPASA 202
             .|.:..|    |..::.|.     |...|   :...:||.|......|    .::|||:.|...
Zfish   122 DRRVDYPWMYEPQLAEIDGNGNMMPFPTGYLHMKFEDSQAVLDDYSDVV----LYERGHLNPDQH 182

  Fly   203 FISTELKKSTFRYLNAIPQYRGVNRGKWKAVETWV----NNMVRGLYDNPIINNVQIPRTYDVLK 263
            ....:.:.:|:...|.:|:.|..|.|.|:..|..:    ||..||             ..|.|..
Zfish   183 QSDPQDRAATYTLTNVVPEIREFNIGPWRQYEERIRVRLNNFCRG-------------TAYIVTG 234

  Fly   264 VCIGALGVHRLRHNTNNNMIPIYLLDNNKIPVPEWMYKIVSHLSGDKW--VMLTYNDVSLPNQQA 326
            |      :|.......||:        |::.:||           |.|  ...|..|.:.|:.:.
Zfish   235 V------IHAGNMIRRNNL--------NRVGIPE-----------DVWSAYCCTDYDRNSPHVER 274

  Fly   327 LNQICHVIPCHPGLNLNTKDVGHTV 351
            ::     .|.:..:..|.|: |:||
Zfish   275 IH-----FPTYAAIAKNAKE-GNTV 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SidNP_651627.1 Endonuclease_NS 106..358 CDD:279553 55/266 (21%)
LOC100002544XP_001920405.3 Endonuclease_NS 95..>273 CDD:214889 49/238 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12511
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556753at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.