DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14062 and EXOG

DIOPT Version :9

Sequence 1:NP_001034074.1 Gene:CG14062 / 43389 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_005098.2 Gene:EXOG / 9941 HGNCID:3347 Length:368 Species:Homo sapiens


Alignment Length:145 Identity:41/145 - (28%)
Similarity:64/145 - (44%) Gaps:22/145 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 NIHGTFRRLFGNNQNYIPNNRDVIINRGHLAASADFFFGDQLCA-TFKYVNAVPQFKSINDGNWE 235
            ||..||...   |::|:.:.    .:|||:|.:.:..|..:..| ||...|.|||....|.|.|.
Human   119 NIPPTFSAF---NEDYVGSG----WSRGHMAPAGNNKFSSKAMAETFYLSNIVPQDFDNNSGYWN 176

  Fly   236 TIERFVRNSVTGNNFVNVRTGARGVLSLP----SGNRPKNVFLSGNRN-PVPQWMYKIV----RN 291
            .||.:.|...  ..|.:|.. ..|.|:||    .|.:..:..:.|..| .||..:||::    .:
Human   177 RIEMYCRELT--ERFEDVWV-VSGPLTLPQTRGDGKKIVSYQVIGEDNVAVPSHLYKVILARRSS 238

  Fly   292 ANNQPIV--AFLTLN 304
            .:.:|:.  ||:..|
Human   239 VSTEPLALGAFVVPN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 41/145 (28%)
EXOGNP_005098.2 NUC 77..286 CDD:214683 41/145 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148110
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.